Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79582
Gene name Gene Name - the full gene name approved by the HGNC.
Sperm associated antigen 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPAG16
Synonyms (NCBI Gene) Gene synonyms aliases
PF20, WDR29
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q34
Summary Summary of gene provided in NCBI Entrez Gene.
Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT712970 hsa-miR-3662 HITS-CLIP 19536157
MIRT712969 hsa-miR-651-3p HITS-CLIP 19536157
MIRT712968 hsa-miR-6828-5p HITS-CLIP 19536157
MIRT712970 hsa-miR-3662 HITS-CLIP 19536157
MIRT712969 hsa-miR-651-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005930 Component Axoneme ISS
GO:0007288 Process Sperm axoneme assembly IEA
GO:0035082 Process Axoneme assembly IBA 21873635
GO:0035082 Process Axoneme assembly IMP 17699735
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612173 23225 ENSG00000144451
Protein
UniProt ID Q8N0X2
Protein name Sperm-associated antigen 16 protein (Pf20 protein homolog)
Protein function Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By sim
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 383 422 WD domain, G-beta repeat Repeat
PF00400 WD40 426 464 WD domain, G-beta repeat Repeat
PF00400 WD40 468 506 WD domain, G-beta repeat Repeat
PF00400 WD40 510 548 WD domain, G-beta repeat Repeat
PF00400 WD40 594 631 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is detected in testis. Isoform 4 is detected in testis and brain, and at lower levels in kidney, heart, pancreas, thyroid, ovary, adrenal gland, spinal cord, trachea and liver. {ECO:0000269|PubMed:11867345, ECO:0000269|PubMed
Sequence
MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYE
EIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKM
GMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADK
AREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKE
KMLTSLERDKVVGQISGLQETLKKLQRGHSYHGPQIKVDHSREKENAPEGPTQKGLREAR
EQNKCKTKMKGNTKDSEFPIDMQPNPNLNVSKESLSPAKFDYKLKNIFRLHELPVSCVSM
QPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHTDWLSDCCFHPSGDKLATSSGDTTVKL
WD
LCKGDCILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNSERCRCTLYGHTDS
VNSIEFFPFSNTLLTSSADKTLSIWD
ARTGICEQSLYGHMHSINDAIFDPRGHMIASCDA
CGVTKLWD
FRKLLPIVSIDIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLM
GHENEAHTVVFSHDGEILFSGGSDGTVRTWS
Sequence length 631
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019 30478444
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 26634245 ClinVar
Attention Deficit Hyperactivity Disorder Attention Deficit Hyperactivity Disorder GWAS
Schizophrenia Schizophrenia GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23956247, 36434627
Bipolar Disorder Associate 24387768
Ciliary Motility Disorders Associate 30300419, 34445527
Colorectal Neoplasms Associate 37434131
Diabetes Mellitus Type 2 Associate 26634513
Infertility Male Associate 22963137
Joint Diseases Associate 23956247
Neuralgia Associate 24387768
Neuroblastoma Associate 23243203
Ocular Motility Disorders Associate 22963137