Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79370
Gene name Gene Name - the full gene name approved by the HGNC.
BCL2 like 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCL2L14
Synonyms (NCBI Gene) Gene synonyms aliases
BCLG
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has be
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT450423 hsa-miR-3663-5p PAR-CLIP 22100165
MIRT450422 hsa-miR-4677-3p PAR-CLIP 22100165
MIRT450421 hsa-miR-4679 PAR-CLIP 22100165
MIRT450420 hsa-miR-4635 PAR-CLIP 22100165
MIRT450419 hsa-miR-570-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11054413, 17280616, 30833792, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA 11054413
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606126 16657 ENSG00000121380
Protein
UniProt ID Q9BZR8
Protein name Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G)
Protein function Plays a role in apoptosis.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is widely expressed. Isoform 2 is testis-specific. {ECO:0000269|PubMed:11054413}.
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGN
CSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTL
EYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEI
FVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDG
LSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKY
LKENFSPWIQQHGGWEKILGISHEEVD
Sequence length 327
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 19671159, 32321829
Breast Neoplasms Stimulate 30075151
Carcinogenesis Associate 17280616
Colorectal Neoplasms Associate 31988296
HIV Infections Associate 30083606
Inflammation Associate 31988296
Inflammatory Bowel Diseases Associate 31988296
Leukemia Myeloid Acute Associate 25213837
Neoplasms Associate 21550398, 32321829
Triple Negative Breast Neoplasms Associate 30075151, 32321829