Gene Gene information from NCBI Gene database.
Entrez ID 79370
Gene name BCL2 like 14
Gene symbol BCL2L14
Synonyms (NCBI Gene)
BCLG
Chromosome 12
Chromosome location 12p13.2
Summary The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has be
miRNA miRNA information provided by mirtarbase database.
65
miRTarBase ID miRNA Experiments Reference
MIRT450423 hsa-miR-3663-5p PAR-CLIP 22100165
MIRT450422 hsa-miR-4677-3p PAR-CLIP 22100165
MIRT450421 hsa-miR-4679 PAR-CLIP 22100165
MIRT450420 hsa-miR-4635 PAR-CLIP 22100165
MIRT450419 hsa-miR-570-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11054413, 17280616, 30833792, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA 11054413
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606126 16657 ENSG00000121380
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BZR8
Protein name Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G)
Protein function Plays a role in apoptosis.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is widely expressed. Isoform 2 is testis-specific. {ECO:0000269|PubMed:11054413}.
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGN
CSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTL
EYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEI
FVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDG
LSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKY
LKENFSPWIQQHGGWEKILGISHEEVD
Sequence length 327
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain