Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79366
Gene name Gene Name - the full gene name approved by the HGNC.
High mobility group nucleosome binding domain 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HMGN5
Synonyms (NCBI Gene) Gene synonyms aliases
NBP-45, NSBP1
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein with similarities to the high mobility group proteins, HMG14 and HMG17, which suggests that this protein may function as a nucleosomal binding and transcriptional activating protein. [provided by RefSeq, Sep 2009]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029263 hsa-miR-26b-5p Microarray 19088304
MIRT608359 hsa-miR-8485 HITS-CLIP 19536157
MIRT608358 hsa-miR-603 HITS-CLIP 19536157
MIRT608355 hsa-miR-1-5p HITS-CLIP 19536157
MIRT608359 hsa-miR-8485 HITS-CLIP 22927820
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0003682 Function Chromatin binding NAS 11161810
GO:0003723 Function RNA binding HDA 22681889
GO:0005634 Component Nucleus NAS 11161810
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300385 8013 ENSG00000198157
Protein
UniProt ID P82970
Protein name High mobility group nucleosome-binding domain-containing protein 5 (Nucleosome-binding protein 1)
Protein function Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01101 HMG14_17 1 99 HMG14 and HMG17 Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11161810}.
Sequence
MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSA
QAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVE
VKEENIEDATEKGGEKKEAVA
AEVKNEEEDQKEDEEDQNEEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGE
DGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKDVKVKEDEKEREDGKE
DEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV
Sequence length 282
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Esophagus neoplasm Squamous cell carcinoma of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 28914995
Glioma Glioma, mixed gliomas, Malignant Glioma rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499
View all (13 more)
22109888
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 22109888
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 25315189
Carcinogenesis Associate 25315189
Carcinoma Squamous Cell Associate 25315189
Colorectal Neoplasms Associate 33629303
Down Syndrome Associate 34946949
Glioma Associate 28109076
Hypoxia Brain Associate 31930127
Lung Neoplasms Associate 22994738
Lymphatic Metastasis Associate 21695596
Lymphatic Metastasis Stimulate 33629303