HSD17B8 (hydroxysteroid 17-beta dehydrogenase 8)

Gene

• Entrez ID: 7923
• Gene name: Hydroxysteroid 17-beta dehydrogenase 8
• Gene symbol: HSD17B8
• Synonyms (NCBI Gene): D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosteron

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023823	hsa-miR-1-3p	Proteomics	18668040
MIRT031735	hsa-miR-16-5p	Proteomics	18668040
MIRT1055475	hsa-miR-3673	CLIP-seq
MIRT1055476	hsa-miR-890	CLIP-seq
MIRT2245050	hsa-miR-214	CLIP-seq
MIRT2245051	hsa-miR-3619-5p	CLIP-seq
MIRT2245052	hsa-miR-4291	CLIP-seq
MIRT2245053	hsa-miR-4459	CLIP-seq
MIRT2245054	hsa-miR-4468	CLIP-seq
MIRT2245055	hsa-miR-4514	CLIP-seq
MIRT2245056	hsa-miR-4645-5p	CLIP-seq
MIRT2245057	hsa-miR-4673	CLIP-seq
MIRT2245058	hsa-miR-4685-5p	CLIP-seq
MIRT2245059	hsa-miR-4692	CLIP-seq
MIRT2245060	hsa-miR-4695-5p	CLIP-seq
MIRT2245061	hsa-miR-4722-5p	CLIP-seq
MIRT2245062	hsa-miR-4755-3p	CLIP-seq
MIRT2245063	hsa-miR-4792	CLIP-seq
MIRT2245064	hsa-miR-761	CLIP-seq
MIRT2245065	hsa-miR-922	CLIP-seq
MIRT2547954	hsa-miR-1292	CLIP-seq
MIRT2547955	hsa-miR-1343	CLIP-seq
MIRT2245050	hsa-miR-214	CLIP-seq
MIRT2547956	hsa-miR-3149	CLIP-seq
MIRT2245051	hsa-miR-3619-5p	CLIP-seq
MIRT2547957	hsa-miR-3713	CLIP-seq
MIRT2245052	hsa-miR-4291	CLIP-seq
MIRT2245053	hsa-miR-4459	CLIP-seq
MIRT2547958	hsa-miR-4471	CLIP-seq
MIRT2245055	hsa-miR-4514	CLIP-seq
MIRT2245056	hsa-miR-4645-5p	CLIP-seq
MIRT2547959	hsa-miR-4646-5p	CLIP-seq
MIRT2245057	hsa-miR-4673	CLIP-seq
MIRT2245059	hsa-miR-4692	CLIP-seq
MIRT2245060	hsa-miR-4695-5p	CLIP-seq
MIRT2547960	hsa-miR-4715-3p	CLIP-seq
MIRT2245061	hsa-miR-4722-5p	CLIP-seq
MIRT2245062	hsa-miR-4755-3p	CLIP-seq
MIRT2245064	hsa-miR-761	CLIP-seq
MIRT2245065	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IBA
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IDA	17978863
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA
GO:0005515	Function	Protein binding	IPI	19571038, 25203508, 28514442, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	19571038
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IMP	25203508
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006703	Process	Estrogen biosynthetic process	IBA
GO:0006703	Process	Estrogen biosynthetic process	IDA	17978863
GO:0006703	Process	Estrogen biosynthetic process	IEA
GO:0008209	Process	Androgen metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0047035	Function	Testosterone dehydrogenase (NAD+) activity	IEA
GO:0048038	Function	Quinone binding	IBA
GO:0051290	Process	Protein heterotetramerization	IDA	25203508
GO:0070404	Function	NADH binding	IDA	25203508
GO:0106386	Function	(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IDA	19571038
GO:0106386	Function	(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IEA
GO:0106386	Function	(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IMP	25203508
GO:1990204	Component	Oxidoreductase complex	IDA	19571038
GO:1990204	Component	Oxidoreductase complex	IMP	25203508

Other IDs

• MIM: 601417
• HGNC: 3554
• e!Ensembl: ENSG00000204228

Protein

• UniProt ID: Q92506
• Protein name: (3R)-3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12) (17-beta-hydroxysteroid dehydrogenase 8) (17-beta-HSD 8) (HSD17B8) (3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit) (KAR alpha subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (Estradiol
• Protein function: Required for the solubility and assembly of the heterotetramer 3-ketoacyl-[acyl carrier protein] (ACP) reductase functional complex (KAR or KAR1) that forms part of the mitochondrial fatty acid synthase (mtFAS). Alpha-subunit of the KAR complex
• PDB: 2PD6, 4CQL, 4CQM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13561	adh_short_C2	18 → 260		Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, particularly abundant in prostate, placenta and kidney (PubMed:17978863). Expressed at protein level in various tissues like brain, cerebellum, heart, lung, kidney, ovary, testis, adrenals and prostate (PubMed:3050857
• Sequence:

  MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGS
  KEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDW
  DKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLT
  QTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
  ASEDSGYITGTSVEVTGGLFM

• Sequence length: 261

Pathways

KEGG:

Fatty acid biosynthesis
Steroid hormone biosynthesis
Metabolic pathways
Fatty acid metabolism

Reactome:

Fatty acyl-CoA biosynthesis