Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7923
Gene name Gene Name - the full gene name approved by the HGNC.	Hydroxysteroid 17-beta dehydrogenase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HSD17B8
Synonyms (NCBI Gene) Gene synonyms aliases	D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosteron

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023823	hsa-miR-1-3p	Proteomics	18668040
MIRT031735	hsa-miR-16-5p	Proteomics	18668040
MIRT1055475	hsa-miR-3673	CLIP-seq
MIRT1055476	hsa-miR-890	CLIP-seq
MIRT2245050	hsa-miR-214	CLIP-seq
MIRT2245051	hsa-miR-3619-5p	CLIP-seq
MIRT2245052	hsa-miR-4291	CLIP-seq
MIRT2245053	hsa-miR-4459	CLIP-seq
MIRT2245054	hsa-miR-4468	CLIP-seq
MIRT2245055	hsa-miR-4514	CLIP-seq
MIRT2245056	hsa-miR-4645-5p	CLIP-seq
MIRT2245057	hsa-miR-4673	CLIP-seq
MIRT2245058	hsa-miR-4685-5p	CLIP-seq
MIRT2245059	hsa-miR-4692	CLIP-seq
MIRT2245060	hsa-miR-4695-5p	CLIP-seq
MIRT2245061	hsa-miR-4722-5p	CLIP-seq
MIRT2245062	hsa-miR-4755-3p	CLIP-seq
MIRT2245063	hsa-miR-4792	CLIP-seq
MIRT2245064	hsa-miR-761	CLIP-seq
MIRT2245065	hsa-miR-922	CLIP-seq
MIRT2547954	hsa-miR-1292	CLIP-seq
MIRT2547955	hsa-miR-1343	CLIP-seq
MIRT2245050	hsa-miR-214	CLIP-seq
MIRT2547956	hsa-miR-3149	CLIP-seq
MIRT2245051	hsa-miR-3619-5p	CLIP-seq
MIRT2547957	hsa-miR-3713	CLIP-seq
MIRT2245052	hsa-miR-4291	CLIP-seq
MIRT2245053	hsa-miR-4459	CLIP-seq
MIRT2547958	hsa-miR-4471	CLIP-seq
MIRT2245055	hsa-miR-4514	CLIP-seq
MIRT2245056	hsa-miR-4645-5p	CLIP-seq
MIRT2547959	hsa-miR-4646-5p	CLIP-seq
MIRT2245057	hsa-miR-4673	CLIP-seq
MIRT2245059	hsa-miR-4692	CLIP-seq
MIRT2245060	hsa-miR-4695-5p	CLIP-seq
MIRT2547960	hsa-miR-4715-3p	CLIP-seq
MIRT2245061	hsa-miR-4722-5p	CLIP-seq
MIRT2245062	hsa-miR-4755-3p	CLIP-seq
MIRT2245064	hsa-miR-761	CLIP-seq
MIRT2245065	hsa-miR-922	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003857	Function	3-hydroxyacyl-CoA dehydrogenase activity	IDA	19571038
GO:0004303	Function	Estradiol 17-beta-dehydrogenase activity	IBA	21873635
GO:0004303	Function	Estradiol 17-beta-dehydrogenase activity	IDA	17978863
GO:0005515	Function	Protein binding	IPI	19571038, 25203508
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	19571038
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA	21873635
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IMP	25203508
GO:0006703	Process	Estrogen biosynthetic process	IBA	21873635
GO:0006703	Process	Estrogen biosynthetic process	IDA	17978863
GO:0006703	Process	Estrogen biosynthetic process	IEA
GO:0008209	Process	Androgen metabolic process	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA	21873635
GO:0046949	Process	Fatty-acyl-CoA biosynthetic process	TAS
GO:0047025	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADH) activity	IMP	25203508
GO:0047035	Function	Testosterone dehydrogenase (NAD+) activity	IEA
GO:0048038	Function	Quinone binding	IBA	21873635
GO:0051290	Process	Protein heterotetramerization	IDA	25203508
GO:0070404	Function	NADH binding	IDA	25203508

MIM	HGNC	e!Ensembl
601417	3554	ENSG00000204228

Protein

UniProt ID

Q92506

Protein name

(3R)-3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12) (17-beta-hydroxysteroid dehydrogenase 8) (17-beta-HSD 8) (HSD17B8) (3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit) (KAR alpha subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (Estradiol

Protein function

Required for the solubility and assembly of the heterotetramer 3-ketoacyl-[acyl carrier protein] (ACP) reductase functional complex (KAR or KAR1) that forms part of the mitochondrial fatty acid synthase (mtFAS). Alpha-subunit of the KAR complex

PDB

2PD6 , 4CQL , 4CQM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	18 → 260		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, particularly abundant in prostate, placenta and kidney (PubMed:17978863). Expressed at protein level in various tissues like brain, cerebellum, heart, lung, kidney, ovary, testis, adrenals and prostate (PubMed:3050857

Sequence

MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGS
KEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDW
DKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLT
QTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Fatty acid biosynthesis Steroid hormone biosynthesis Metabolic pathways Fatty acid metabolism		Fatty acyl-CoA biosynthesis

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	17804836, 19503088

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	35184130
Obesity	Associate	35184130
Ovarian Neoplasms	Associate	34793589

HSD17B8 (hydroxysteroid 17-beta dehydrogenase 8)