Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7923
Gene name Gene Name - the full gene name approved by the HGNC.	Hydroxysteroid 17-beta dehydrogenase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HSD17B8
Synonyms (NCBI Gene) Gene synonyms aliases	D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosteron

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023823	hsa-miR-1-3p	Proteomics	18668040
MIRT031735	hsa-miR-16-5p	Proteomics	18668040
MIRT1055475	hsa-miR-3673	CLIP-seq
MIRT1055476	hsa-miR-890	CLIP-seq
MIRT2245050	hsa-miR-214	CLIP-seq
MIRT2245051	hsa-miR-3619-5p	CLIP-seq
MIRT2245052	hsa-miR-4291	CLIP-seq
MIRT2245053	hsa-miR-4459	CLIP-seq
MIRT2245054	hsa-miR-4468	CLIP-seq
MIRT2245055	hsa-miR-4514	CLIP-seq
MIRT2245056	hsa-miR-4645-5p	CLIP-seq
MIRT2245057	hsa-miR-4673	CLIP-seq
MIRT2245058	hsa-miR-4685-5p	CLIP-seq
MIRT2245059	hsa-miR-4692	CLIP-seq
MIRT2245060	hsa-miR-4695-5p	CLIP-seq
MIRT2245061	hsa-miR-4722-5p	CLIP-seq
MIRT2245062	hsa-miR-4755-3p	CLIP-seq
MIRT2245063	hsa-miR-4792	CLIP-seq
MIRT2245064	hsa-miR-761	CLIP-seq
MIRT2245065	hsa-miR-922	CLIP-seq
MIRT2547954	hsa-miR-1292	CLIP-seq
MIRT2547955	hsa-miR-1343	CLIP-seq
MIRT2245050	hsa-miR-214	CLIP-seq
MIRT2547956	hsa-miR-3149	CLIP-seq
MIRT2245051	hsa-miR-3619-5p	CLIP-seq
MIRT2547957	hsa-miR-3713	CLIP-seq
MIRT2245052	hsa-miR-4291	CLIP-seq
MIRT2245053	hsa-miR-4459	CLIP-seq
MIRT2547958	hsa-miR-4471	CLIP-seq
MIRT2245055	hsa-miR-4514	CLIP-seq
MIRT2245056	hsa-miR-4645-5p	CLIP-seq
MIRT2547959	hsa-miR-4646-5p	CLIP-seq
MIRT2245057	hsa-miR-4673	CLIP-seq
MIRT2245059	hsa-miR-4692	CLIP-seq
MIRT2245060	hsa-miR-4695-5p	CLIP-seq
MIRT2547960	hsa-miR-4715-3p	CLIP-seq
MIRT2245061	hsa-miR-4722-5p	CLIP-seq
MIRT2245062	hsa-miR-4755-3p	CLIP-seq
MIRT2245064	hsa-miR-761	CLIP-seq
MIRT2245065	hsa-miR-922	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IBA
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IDA	17978863
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA
GO:0005515	Function	Protein binding	IPI	19571038, 25203508, 28514442, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	19571038
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IMP	25203508
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006703	Process	Estrogen biosynthetic process	IBA
GO:0006703	Process	Estrogen biosynthetic process	IDA	17978863
GO:0006703	Process	Estrogen biosynthetic process	IEA
GO:0008209	Process	Androgen metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0047035	Function	Testosterone dehydrogenase (NAD+) activity	IEA
GO:0048038	Function	Quinone binding	IBA
GO:0051290	Process	Protein heterotetramerization	IDA	25203508
GO:0070404	Function	NADH binding	IDA	25203508
GO:0106386	Function	(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IDA	19571038
GO:0106386	Function	(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IEA
GO:0106386	Function	(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IMP	25203508
GO:1990204	Component	Oxidoreductase complex	IDA	19571038
GO:1990204	Component	Oxidoreductase complex	IMP	25203508

MIM	HGNC	e!Ensembl
601417	3554	ENSG00000204228

Protein

UniProt ID

Q92506

Protein name

(3R)-3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12) (17-beta-hydroxysteroid dehydrogenase 8) (17-beta-HSD 8) (HSD17B8) (3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit) (KAR alpha subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (Estradiol

Protein function

Required for the solubility and assembly of the heterotetramer 3-ketoacyl-[acyl carrier protein] (ACP) reductase functional complex (KAR or KAR1) that forms part of the mitochondrial fatty acid synthase (mtFAS). Alpha-subunit of the KAR complex

PDB

2PD6 , 4CQL , 4CQM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	18 → 260		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, particularly abundant in prostate, placenta and kidney (PubMed:17978863). Expressed at protein level in various tissues like brain, cerebellum, heart, lung, kidney, ovary, testis, adrenals and prostate (PubMed:3050857

Sequence

MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGS
KEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDW
DKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLT
QTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Fatty acid biosynthesis Steroid hormone biosynthesis Metabolic pathways Fatty acid metabolism		Fatty acyl-CoA biosynthesis

HSD17B8 (hydroxysteroid 17-beta dehydrogenase 8)