Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79191
Gene name Gene Name - the full gene name approved by the HGNC.	Iroquois homeobox 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRX3
Synonyms (NCBI Gene) Gene synonyms aliases	IRX-1, IRXB1
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation

Show/Hide all(126)

miRTarBase ID	miRNA	Experiments
MIRT1072323	hsa-miR-1227	CLIP-seq
MIRT1072324	hsa-miR-1284	CLIP-seq
MIRT1072325	hsa-miR-2110	CLIP-seq
MIRT1072326	hsa-miR-300	CLIP-seq
MIRT1072327	hsa-miR-3064-3p	CLIP-seq
MIRT1072328	hsa-miR-3121-3p	CLIP-seq
MIRT1072329	hsa-miR-3140-3p	CLIP-seq
MIRT1072330	hsa-miR-3150a-3p	CLIP-seq
MIRT1072331	hsa-miR-3150b-3p	CLIP-seq
MIRT1072332	hsa-miR-3169	CLIP-seq
MIRT1072333	hsa-miR-3175	CLIP-seq
MIRT1072334	hsa-miR-329	CLIP-seq
MIRT1072335	hsa-miR-331-5p	CLIP-seq
MIRT1072336	hsa-miR-342-5p	CLIP-seq
MIRT1072337	hsa-miR-362-3p	CLIP-seq
MIRT1072338	hsa-miR-3687	CLIP-seq
MIRT1072339	hsa-miR-377	CLIP-seq
MIRT1072340	hsa-miR-381	CLIP-seq
MIRT1072341	hsa-miR-382	CLIP-seq
MIRT1072342	hsa-miR-3941	CLIP-seq
MIRT1072343	hsa-miR-3973	CLIP-seq
MIRT1072344	hsa-miR-4442	CLIP-seq
MIRT1072345	hsa-miR-4446-3p	CLIP-seq
MIRT1072346	hsa-miR-4515	CLIP-seq
MIRT1072347	hsa-miR-4656	CLIP-seq
MIRT1072348	hsa-miR-4660	CLIP-seq
MIRT1072349	hsa-miR-4662a-5p	CLIP-seq
MIRT1072350	hsa-miR-4664-5p	CLIP-seq
MIRT1072351	hsa-miR-4666-3p	CLIP-seq
MIRT1072352	hsa-miR-4678	CLIP-seq
MIRT1072353	hsa-miR-4689	CLIP-seq
MIRT1072354	hsa-miR-4706	CLIP-seq
MIRT1072355	hsa-miR-4721	CLIP-seq
MIRT1072356	hsa-miR-4728-5p	CLIP-seq
MIRT1072357	hsa-miR-4729	CLIP-seq
MIRT1072358	hsa-miR-4742-3p	CLIP-seq
MIRT1072359	hsa-miR-4749-5p	CLIP-seq
MIRT1072360	hsa-miR-4768-5p	CLIP-seq
MIRT1072361	hsa-miR-4784	CLIP-seq
MIRT1072362	hsa-miR-4789-3p	CLIP-seq
MIRT1072363	hsa-miR-4789-5p	CLIP-seq
MIRT1072364	hsa-miR-4796-3p	CLIP-seq
MIRT1072365	hsa-miR-4797-5p	CLIP-seq
MIRT1072366	hsa-miR-495	CLIP-seq
MIRT1072367	hsa-miR-520g	CLIP-seq
MIRT1072368	hsa-miR-520h	CLIP-seq
MIRT1072369	hsa-miR-556-3p	CLIP-seq
MIRT1072370	hsa-miR-561	CLIP-seq
MIRT1072371	hsa-miR-602	CLIP-seq
MIRT1072372	hsa-miR-603	CLIP-seq
MIRT1072373	hsa-miR-646	CLIP-seq
MIRT1072374	hsa-miR-659	CLIP-seq
MIRT1072375	hsa-miR-744	CLIP-seq
MIRT1072376	hsa-miR-885-3p	CLIP-seq
MIRT1072377	hsa-miR-939	CLIP-seq
MIRT1072378	hsa-miR-944	CLIP-seq
MIRT2017857	hsa-miR-1229	CLIP-seq
MIRT1072324	hsa-miR-1284	CLIP-seq
MIRT1072328	hsa-miR-3121-3p	CLIP-seq
MIRT1072335	hsa-miR-331-5p	CLIP-seq
MIRT1072339	hsa-miR-377	CLIP-seq
MIRT1072341	hsa-miR-382	CLIP-seq
MIRT1072343	hsa-miR-3973	CLIP-seq
MIRT2017858	hsa-miR-4420	CLIP-seq
MIRT1072348	hsa-miR-4660	CLIP-seq
MIRT1072349	hsa-miR-4662a-5p	CLIP-seq
MIRT1072352	hsa-miR-4678	CLIP-seq
MIRT1072357	hsa-miR-4729	CLIP-seq
MIRT2017859	hsa-miR-4738-3p	CLIP-seq
MIRT1072358	hsa-miR-4742-3p	CLIP-seq
MIRT1072360	hsa-miR-4768-5p	CLIP-seq
MIRT1072362	hsa-miR-4789-3p	CLIP-seq
MIRT1072363	hsa-miR-4789-5p	CLIP-seq
MIRT1072364	hsa-miR-4796-3p	CLIP-seq
MIRT1072367	hsa-miR-520g	CLIP-seq
MIRT1072368	hsa-miR-520h	CLIP-seq
MIRT1072371	hsa-miR-602	CLIP-seq
MIRT1072373	hsa-miR-646	CLIP-seq
MIRT1072374	hsa-miR-659	CLIP-seq
MIRT1072376	hsa-miR-885-3p	CLIP-seq
MIRT1072323	hsa-miR-1227	CLIP-seq
MIRT1072325	hsa-miR-2110	CLIP-seq
MIRT1072327	hsa-miR-3064-3p	CLIP-seq
MIRT1072328	hsa-miR-3121-3p	CLIP-seq
MIRT1072330	hsa-miR-3150a-3p	CLIP-seq
MIRT1072331	hsa-miR-3150b-3p	CLIP-seq
MIRT2249658	hsa-miR-3166	CLIP-seq
MIRT1072332	hsa-miR-3169	CLIP-seq
MIRT1072333	hsa-miR-3175	CLIP-seq
MIRT1072334	hsa-miR-329	CLIP-seq
MIRT1072336	hsa-miR-342-5p	CLIP-seq
MIRT1072337	hsa-miR-362-3p	CLIP-seq
MIRT2249659	hsa-miR-3714	CLIP-seq
MIRT1072342	hsa-miR-3941	CLIP-seq
MIRT1072343	hsa-miR-3973	CLIP-seq
MIRT1072345	hsa-miR-4446-3p	CLIP-seq
MIRT1072346	hsa-miR-4515	CLIP-seq
MIRT1072347	hsa-miR-4656	CLIP-seq
MIRT1072348	hsa-miR-4660	CLIP-seq
MIRT1072349	hsa-miR-4662a-5p	CLIP-seq
MIRT1072350	hsa-miR-4664-5p	CLIP-seq
MIRT1072353	hsa-miR-4689	CLIP-seq
MIRT1072354	hsa-miR-4706	CLIP-seq
MIRT1072355	hsa-miR-4721	CLIP-seq
MIRT1072356	hsa-miR-4728-5p	CLIP-seq
MIRT1072357	hsa-miR-4729	CLIP-seq
MIRT1072358	hsa-miR-4742-3p	CLIP-seq
MIRT1072359	hsa-miR-4749-5p	CLIP-seq
MIRT1072360	hsa-miR-4768-5p	CLIP-seq
MIRT1072361	hsa-miR-4784	CLIP-seq
MIRT1072363	hsa-miR-4789-5p	CLIP-seq
MIRT1072364	hsa-miR-4796-3p	CLIP-seq
MIRT1072366	hsa-miR-495	CLIP-seq
MIRT1072367	hsa-miR-520g	CLIP-seq
MIRT1072368	hsa-miR-520h	CLIP-seq
MIRT2249660	hsa-miR-548an	CLIP-seq
MIRT2249661	hsa-miR-550b	CLIP-seq
MIRT1072372	hsa-miR-603	CLIP-seq
MIRT1072373	hsa-miR-646	CLIP-seq
MIRT1072375	hsa-miR-744	CLIP-seq
MIRT1072376	hsa-miR-885-3p	CLIP-seq
MIRT1072377	hsa-miR-939	CLIP-seq
MIRT1072338	hsa-miR-3687	CLIP-seq
MIRT1072344	hsa-miR-4442	CLIP-seq
MIRT1072338	hsa-miR-3687	CLIP-seq
MIRT1072344	hsa-miR-4442	CLIP-seq

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	21825130
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	21825130
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	21825130
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	21825130
GO:0001656	Process	Metanephros development	IEA
GO:0003165	Process	Purkinje myocyte development	IEA
GO:0003165	Process	Purkinje myocyte development	ISS
GO:0003167	Process	Atrioventricular bundle cell differentiation	IEA
GO:0003167	Process	Atrioventricular bundle cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007498	Process	Mesoderm development	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	21825130
GO:0048468	Process	Cell development	IBA
GO:0060932	Process	His-Purkinje system cell differentiation	IEA
GO:0060932	Process	His-Purkinje system cell differentiation	ISS
GO:0072047	Process	Proximal/distal pattern formation involved in nephron development	IEA
GO:0072086	Process	Specification of loop of Henle identity	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	IEA
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	ISS	21825130
GO:1903598	Process	Positive regulation of gap junction assembly	IEA
GO:1903598	Process	Positive regulation of gap junction assembly	ISS	21825130
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
612985	14360	ENSG00000177508

Protein

UniProt ID

P78415

Protein name

Iroquois-class homeodomain protein IRX-3 (Homeodomain protein IRXB1) (Iroquois homeobox protein 3)

Protein function

Transcription factor involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05920	Homeobox_KN	145 → 184	Homeobox KN domain	Family

Sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAP
YAAAAAAAAAQGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPY
GQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDGKRELELEEEELGGEEEDT
GGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPISDSKNSDSEDSSEGL
EDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIWSLAETATSPD
NPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQP
VPRRPQNHLDAALVLSALSSS

Sequence length

501

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Eosinophilia	Eosinophilic esophagitis	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Aortic Valve Stenosis	Associate	37697352
Body Weight	Associate	36415696
Fatty Liver	Associate	35957832
Fibrosis	Associate	37697352
Hodgkin Disease	Stimulate	33539429
Hypertrophy	Associate	27560134
Inflammation	Associate	27560134
Leukemia Myeloid Acute	Associate	35328612
Melanoma	Associate	38077400
Metabolic Diseases	Associate	36415696
Neoplasms	Associate	20847289
Obesity	Associate	26440677, 27560134, 30166627, 31126299, 31771407, 32651404, 34399781, 36415696, 37433298
Overweight	Associate	31126299, 34399781
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	36233173
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	36233173
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	39316719
Sleep Deprivation	Stimulate	35957832

IRX3 (iroquois homeobox 3)