Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79191
Gene name Gene Name - the full gene name approved by the HGNC.
Iroquois homeobox 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IRX3
Synonyms (NCBI Gene) Gene synonyms aliases
IRX-1, IRXB1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1072323 hsa-miR-1227 CLIP-seq
MIRT1072324 hsa-miR-1284 CLIP-seq
MIRT1072325 hsa-miR-2110 CLIP-seq
MIRT1072326 hsa-miR-300 CLIP-seq
MIRT1072327 hsa-miR-3064-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001656 Process Metanephros development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612985 14360 ENSG00000177508
Protein
UniProt ID P78415
Protein name Iroquois-class homeodomain protein IRX-3 (Homeodomain protein IRXB1) (Iroquois homeobox protein 3)
Protein function Transcription factor involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05920 Homeobox_KN 145 184 Homeobox KN domain Family
Sequence
MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAP
YAAAAAAAAAQGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPY
GQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRR
LKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDGKRELELEEEELGGEEEDT
GGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPISDSKNSDSEDSSEGL
EDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIWSLAETATSPD
NPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQP
VPRRPQNHLDAALVLSALSSS
Sequence length 501
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Eosinophilia Eosinophilia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Aortic Valve Stenosis Associate 37697352
Body Weight Associate 36415696
Fatty Liver Associate 35957832
Fibrosis Associate 37697352
Hodgkin Disease Stimulate 33539429
Hypertrophy Associate 27560134
Inflammation Associate 27560134
Leukemia Myeloid Acute Associate 35328612
Melanoma Associate 38077400
Metabolic Diseases Associate 36415696