FSD1 (fibronectin type III and SPRY domain containing 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79187
Gene name Gene Name - the full gene name approved by the HGNC.
Fibronectin type III and SPRY domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FSD1
Synonyms (NCBI Gene) Gene synonyms aliases
GLFND, MIR1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a centrosome associated protein that is characterized by an N-terminal coiled-coil region downstream of B-box (BBC) domain, a central fibronectin type III domain, and a C-terminal repeats in splA and RyR (SPRY) domain. The encoded protei
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(28)
miRTarBase ID miRNA Experiments Reference
MIRT1005441 hsa-miR-3150a-3p CLIP-seq
MIRT1005442 hsa-miR-3175 CLIP-seq
MIRT1005443 hsa-miR-4258 CLIP-seq
MIRT1005444 hsa-miR-4707-3p CLIP-seq
MIRT1005445 hsa-miR-491-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IMP 12154070
GO:0005874 Component Microtubule IMP 12154070, 12445389
GO:0007049 Process Cell cycle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609828 13745 ENSG00000105255
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9BTV5
Protein name Fibronectin type III and SPRY domain-containing protein 1 (MID1-related protein 1) (Microtubule-associated protein GLFND)
Protein function May be involved in microtubule organization and stabilization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 167 → 258 Fibronectin type III domain Domain
PF00622 SPRY 355 → 473 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain tissues, including cerebellum, cerebral cortex, medulla, occipital pole, frontal lobe, temporal lobe and putamen. Lower expression in spinal cord. {ECO:0000269|PubMed:11267680, ECO:0000269|PubMed:12154070}.
Sequence 
MEEQREALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN
CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPD
CLGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
LQKRGSATSSSNTSLT
Sequence length 496
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)		 16367923
Show/Hide Text Mining Associations (117)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Associate 37373283
Acute Coronary Syndrome Associate 28666417
Acute On Chronic Liver Failure Associate 26267843
Adenocarcinoma of Lung Associate 36260870
Adenoma Associate 21694772
Alopecia Associate 35545365
Amyotrophic Lateral Sclerosis Associate 29466830
Anemia Aplastic Inhibit 27658437
Angina Stable Associate 24260372
Aortic Aneurysm Abdominal Associate 32605321