FSD1 (fibronectin type III and SPRY domain containing 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 79187
Gene name Fibronectin type III and SPRY domain containing 1
Gene symbol FSD1
Synonyms (NCBI Gene)
GLFNDMIR1
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a centrosome associated protein that is characterized by an N-terminal coiled-coil region downstream of B-box (BBC) domain, a central fibronectin type III domain, and a C-terminal repeats in splA and RyR (SPRY) domain. The encoded protei
miRNA miRNA information provided by mirtarbase database.
28
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (28)
miRTarBase ID miRNA Experiments Reference
MIRT1005441 hsa-miR-3150a-3p CLIP-seq
MIRT1005442 hsa-miR-3175 CLIP-seq
MIRT1005443 hsa-miR-4258 CLIP-seq
MIRT1005444 hsa-miR-4707-3p CLIP-seq
MIRT1005445 hsa-miR-491-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IEA
GO:0005813 Component Centrosome IMP 12154070
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609828 13745 ENSG00000105255
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BTV5
Protein name Fibronectin type III and SPRY domain-containing protein 1 (MID1-related protein 1) (Microtubule-associated protein GLFND)
Protein function May be involved in microtubule organization and stabilization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 167 → 258 Fibronectin type III domain Domain
PF00622 SPRY 355 → 473 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain tissues, including cerebellum, cerebral cortex, medulla, occipital pole, frontal lobe, temporal lobe and putamen. Lower expression in spinal cord. {ECO:0000269|PubMed:11267680, ECO:0000269|PubMed:12154070}.
Sequence 
MEEQREALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN
CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPD
CLGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
LQKRGSATSSSNTSLT
Sequence length 496
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (8)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs35224881 RCV005910524
Clear cell carcinoma of kidney Benign; Likely benign rs151077874 RCV005906762
Colon adenocarcinoma Benign; Likely benign rs151077874 RCV005906761
Lung cancer Benign rs35224881 RCV005910528
Show/Hide Text Mining Associations (117)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 37373283
Acute Coronary Syndrome Associate 28666417
Acute On Chronic Liver Failure Associate 26267843
Adenocarcinoma of Lung Associate 36260870
Adenoma Associate 21694772
Alopecia Associate 35545365
Amyotrophic Lateral Sclerosis Associate 29466830
Anemia Aplastic Inhibit 27658437
Angina Stable Associate 24260372
Aortic Aneurysm Abdominal Associate 32605321