Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7917
Gene name Gene Name - the full gene name approved by the HGNC.	BAG cochaperone 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BAG6
Synonyms (NCBI Gene) Gene synonyms aliases	BAG-6, BAT3, D6S52E, G3
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025262	hsa-miR-34a-5p	Proteomics	21566225
MIRT025262	hsa-miR-34a-5p	Proteomics	21566225
MIRT031479	hsa-miR-16-5p	Proteomics	18668040
MIRT051911	hsa-let-7b-5p	CLASH	23622248
MIRT049283	hsa-miR-92a-3p	CLASH	23622248
MIRT046630	hsa-miR-222-3p	CLASH	23622248
MIRT043997	hsa-miR-378a-5p	CLASH	23622248
MIRT043466	hsa-miR-331-3p	CLASH	23622248
MIRT041655	hsa-miR-484	CLASH	23622248
MIRT041655	hsa-miR-484	CLASH	23622248
MIRT041258	hsa-miR-193b-3p	CLASH	23622248
MIRT041258	hsa-miR-193b-3p	CLASH	23622248
MIRT040645	hsa-miR-92b-3p	CLASH	23622248
MIRT039860	hsa-miR-615-3p	CLASH	23622248
MIRT039860	hsa-miR-615-3p	CLASH	23622248
MIRT037504	hsa-miR-744-5p	CLASH	23622248
MIRT037504	hsa-miR-744-5p	CLASH	23622248
MIRT036783	hsa-miR-760	CLASH	23622248
MIRT036531	hsa-miR-1226-3p	CLASH	23622248
MIRT441129	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441129	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT2179906	hsa-miR-1252	CLIP-seq
MIRT2179907	hsa-miR-200b	CLIP-seq
MIRT2179908	hsa-miR-200c	CLIP-seq
MIRT2179909	hsa-miR-3611	CLIP-seq
MIRT2179910	hsa-miR-429	CLIP-seq
MIRT2179911	hsa-miR-4318	CLIP-seq
MIRT2179912	hsa-miR-4693-5p	CLIP-seq
MIRT2179913	hsa-miR-553	CLIP-seq
MIRT2179914	hsa-miR-625	CLIP-seq
MIRT2179915	hsa-miR-892a	CLIP-seq

Show/Hide all(80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002429	Process	Immune response-activating cell surface receptor signaling pathway	IDA	18852879
GO:0005102	Function	Signaling receptor binding	IPI	18852879
GO:0005515	Function	Protein binding	IPI	14667819, 14960581, 16189514, 17403783, 18055229, 18765639, 18852879, 21903422, 22046132, 22807449, 23246001, 24133212, 25036637, 25416956, 25535373, 25713138, 26496610, 26876100, 27113755, 28514442, 29042515, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	14960581, 17403783, 21636303, 29042515
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21636303
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	17403783, 20676083, 23246001, 29042515
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	25535373
GO:0006325	Process	Chromatin organization	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	20676083
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS
GO:0006620	Process	Post-translational protein targeting to endoplasmic reticulum membrane	IDA	25535373
GO:0006915	Process	Apoptotic process	IDA	14960581
GO:0006915	Process	Apoptotic process	IEA
GO:0007130	Process	Synaptonemal complex assembly	IEA
GO:0007130	Process	Synaptonemal complex assembly	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0010498	Process	Proteasomal protein catabolic process	IMP	26565908
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	23246001
GO:0018393	Process	Internal peptidyl-lysine acetylation	IDA	17403783
GO:0030101	Process	Natural killer cell activation	IDA	18852879
GO:0030154	Process	Cell differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030324	Process	Lung development	ISS
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IBA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IEA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21636303, 24981174
GO:0031647	Process	Regulation of protein stability	IDA	21636303
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IDA	23129660, 24981174
GO:0036503	Process	ERAD pathway	IMP	26565908
GO:0036503	Process	ERAD pathway	NAS	21636303
GO:0036506	Process	Maintenance of unfolded protein	IMP	21636303
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	17403783
GO:0042802	Function	Identical protein binding	IPI	24133212
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043022	Function	Ribosome binding	IDA	20676083
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0045861	Process	Negative regulation of proteolysis	IEA
GO:0045861	Process	Negative regulation of proteolysis	ISS
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0048018	Function	Receptor ligand activity	IDA	18852879
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0051132	Process	NK T cell activation	IDA	18852879
GO:0051132	Process	NK T cell activation	IDA	18852879
GO:0051787	Function	Misfolded protein binding	IBA
GO:0051787	Function	Misfolded protein binding	IDA	21636303
GO:0060090	Function	Molecular adaptor activity	EXP	25713138
GO:0061857	Process	Endoplasmic reticulum stress-induced pre-emptive quality control	IMP	26565908
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS
GO:0070062	Component	Extracellular exosome	IDA	18852879
GO:0070628	Function	Proteasome binding	IEA
GO:0070628	Function	Proteasome binding	ISS
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IDA	20676083, 25535373
GO:0071818	Component	BAT3 complex	IBA
GO:0071818	Component	BAT3 complex	IDA	20676083, 21636303, 25535373
GO:0071818	Component	BAT3 complex	IPI	25535373
GO:0140597	Function	Protein carrier chaperone	IDA	21636303
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	24424410
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	24424410

MIM	HGNC	e!Ensembl
142590	13919	ENSG00000204463

Protein

UniProt ID

P46379

Protein name

Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe)

Protein function

ATP-independent molecular chaperone preventing the aggregation of misfolded and hydrophobic patches-containing proteins (PubMed:21636303). Functions as part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, which maintains t

PDB

1WX9 , 2N9P , 4DWF , 4EEW , 4WWR , 4X86 , 6AU8 , 7RU9 , 7RUA , 7RUC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	19 → 89	Ubiquitin family	Domain
PF12057	BAG6	276 → 392	BCL2-associated athanogene 6	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by immature dendritic cells (at protein level). {ECO:0000269|PubMed:18852879}.

Sequence

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVE
ERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEV
LGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRP
MSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNV
ESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLG
PPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQM
VSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQP
SMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPP
PPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARA
GSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQR
LQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLE
FLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIR
RMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGA
ERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVP
IIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLT
SPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP

Sequence length

1132

Interactions

View interactions

	KEGG
	Protein export

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dental caries	Dental caries	N/A	N/A	GWAS
Diabetes	Type 2 diabetes mellitus or coronary artery disease (pleiotropy)	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Takayasu Arteritis	Takayasu arteritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	39201500
Anxiety Disorders	Associate	34741163
Ataxia Telangiectasia	Associate	37296624
Carcinoma Hepatocellular	Associate	29706626
Carcinoma Non Small Cell Lung	Associate	25884493
Carcinoma Squamous Cell	Associate	35499292
Coronary Aneurysm	Associate	20626023
Coronary Artery Disease	Associate	39201500
Diabetes Mellitus Type 2	Associate	27515906
Epilepsy	Associate	24861996
Gastroesophageal Reflux	Associate	20385987
Glioblastoma	Associate	39513882
Graft vs Host Disease	Associate	33446692
Hypertension	Associate	37175507
Irritable Bowel Syndrome	Associate	34741163
Knee Injuries	Associate	25231575
Leukemia Lymphocytic Chronic B Cell	Associate	32986360
Lung Neoplasms	Associate	18757527, 20106900, 25884493, 35499292, 37307368
Lymphoma	Associate	24244368
Mucocutaneous Lymph Node Syndrome	Associate	20626023
Neoplasms	Associate	24244368, 36380017
Obesity	Associate	27515906
Osteoarthritis	Associate	25231575
Osteosarcoma	Associate	19018758
Overweight	Associate	27515906
Psoriasis	Associate	34589554
Pulmonary Arterial Hypertension	Associate	37176017
Pulmonary Disease Chronic Obstructive	Associate	37307368
Stevens Johnson Syndrome	Associate	15743917, 24861996

BAG6 (BAG cochaperone 6)