Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79109
Gene name Gene Name - the full gene name approved by the HGNC.	MAPK associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPKAP1
Synonyms (NCBI Gene) Gene synonyms aliases	JC310, MIP1, SIN1, SIN1b, SIN1g
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q33.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019887	hsa-miR-375	Microarray	20215506
MIRT029925	hsa-miR-26b-5p	Microarray	19088304
MIRT1131387	hsa-miR-4457	CLIP-seq
MIRT1131388	hsa-miR-513b	CLIP-seq
MIRT1131389	hsa-miR-1323	CLIP-seq
MIRT1131390	hsa-miR-371b-5p	CLIP-seq
MIRT1131391	hsa-miR-3913-3p	CLIP-seq
MIRT1131392	hsa-miR-455-3p	CLIP-seq
MIRT1131393	hsa-miR-4712-5p	CLIP-seq
MIRT1131394	hsa-miR-489	CLIP-seq
MIRT1131395	hsa-miR-548o	CLIP-seq
MIRT1131396	hsa-miR-770-5p	CLIP-seq
MIRT1131397	hsa-miR-888	CLIP-seq
MIRT1131398	hsa-miR-3144-5p	CLIP-seq
MIRT1131399	hsa-miR-3191	CLIP-seq
MIRT1131391	hsa-miR-3913-3p	CLIP-seq
MIRT1131387	hsa-miR-4457	CLIP-seq
MIRT1131400	hsa-miR-4645-3p	CLIP-seq
MIRT1131401	hsa-miR-4652-5p	CLIP-seq
MIRT1131402	hsa-miR-4667-5p	CLIP-seq
MIRT1131403	hsa-miR-4700-5p	CLIP-seq
MIRT1131404	hsa-miR-499-3p	CLIP-seq
MIRT1131405	hsa-miR-499a-3p	CLIP-seq
MIRT1131388	hsa-miR-513b	CLIP-seq
MIRT1131406	hsa-miR-889	CLIP-seq
MIRT1131407	hsa-miR-1343	CLIP-seq
MIRT1131408	hsa-miR-378g	CLIP-seq
MIRT1131409	hsa-miR-3921	CLIP-seq
MIRT1131410	hsa-miR-4437	CLIP-seq
MIRT1131411	hsa-miR-4649-3p	CLIP-seq
MIRT1131412	hsa-miR-4653-5p	CLIP-seq
MIRT1131413	hsa-miR-4660	CLIP-seq
MIRT1131414	hsa-miR-4674	CLIP-seq
MIRT1131415	hsa-miR-564	CLIP-seq
MIRT1131416	hsa-miR-760	CLIP-seq
MIRT2267340	hsa-miR-485-5p	CLIP-seq
MIRT2390600	hsa-miR-2110	CLIP-seq
MIRT2390601	hsa-miR-3125	CLIP-seq
MIRT2390602	hsa-miR-3151	CLIP-seq
MIRT2390603	hsa-miR-3916	CLIP-seq
MIRT2390604	hsa-miR-4271	CLIP-seq
MIRT2390605	hsa-miR-4447	CLIP-seq
MIRT2390606	hsa-miR-4472	CLIP-seq
MIRT2390607	hsa-miR-4725-3p	CLIP-seq
MIRT2390608	hsa-miR-491-5p	CLIP-seq
MIRT2567085	hsa-miR-1231	CLIP-seq
MIRT1131407	hsa-miR-1343	CLIP-seq
MIRT2567086	hsa-miR-149	CLIP-seq
MIRT2567087	hsa-miR-191	CLIP-seq
MIRT2567088	hsa-miR-3064-5p	CLIP-seq
MIRT2567089	hsa-miR-3182	CLIP-seq
MIRT2567090	hsa-miR-329	CLIP-seq
MIRT2567091	hsa-miR-362-3p	CLIP-seq
MIRT2567092	hsa-miR-3652	CLIP-seq
MIRT2567093	hsa-miR-3653	CLIP-seq
MIRT2567094	hsa-miR-3658	CLIP-seq
MIRT2567095	hsa-miR-3667-5p	CLIP-seq
MIRT1131408	hsa-miR-378g	CLIP-seq
MIRT1131409	hsa-miR-3921	CLIP-seq
MIRT2567096	hsa-miR-4251	CLIP-seq
MIRT2567097	hsa-miR-4303	CLIP-seq
MIRT2567098	hsa-miR-4326	CLIP-seq
MIRT2567099	hsa-miR-4329	CLIP-seq
MIRT2567100	hsa-miR-4430	CLIP-seq
MIRT1131410	hsa-miR-4437	CLIP-seq
MIRT2567101	hsa-miR-4462	CLIP-seq
MIRT2567102	hsa-miR-4505	CLIP-seq
MIRT2567103	hsa-miR-4520a-3p	CLIP-seq
MIRT2567104	hsa-miR-4520b-3p	CLIP-seq
MIRT1131411	hsa-miR-4649-3p	CLIP-seq
MIRT1131412	hsa-miR-4653-5p	CLIP-seq
MIRT2567105	hsa-miR-4659a-3p	CLIP-seq
MIRT2567106	hsa-miR-4659b-3p	CLIP-seq
MIRT1131413	hsa-miR-4660	CLIP-seq
MIRT1131414	hsa-miR-4674	CLIP-seq
MIRT2567107	hsa-miR-4794	CLIP-seq
MIRT2567108	hsa-miR-539	CLIP-seq
MIRT2567109	hsa-miR-591	CLIP-seq
MIRT2567110	hsa-miR-593	CLIP-seq
MIRT2567111	hsa-miR-654-3p	CLIP-seq
MIRT1131416	hsa-miR-760	CLIP-seq

Show/Hide all(75)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	24365180, 24670654, 28934384, 29567957, 33378666, 35512704
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IBA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	17303383
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	17303383, 26293922
GO:0005634	Component	Nucleus	IDA	26263164
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	26263164
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	28143890
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005764	Component	Lysosome	IDA	31130364
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	28143890
GO:0005770	Component	Late endosome	IDA	28143890
GO:0005783	Component	Endoplasmic reticulum	IDA	21867682
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	17303383
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	26263164
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26263164, 28143890
GO:0005886	Component	Plasma membrane	IDA	17303383
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IDA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	18498745
GO:0007010	Process	Cytoskeleton organization	NAS	15268862
GO:0008286	Process	Insulin receptor signaling pathway	IDA	38056462
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	21177249
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030307	Process	Positive regulation of cell growth	NAS	22500797
GO:0031267	Function	Small GTPase binding	IDA	17303383
GO:0031669	Process	Cellular response to nutrient levels	NAS	22500797
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0031932	Component	TORC2 complex	IBA
GO:0031932	Component	TORC2 complex	IDA	26263164
GO:0031932	Component	TORC2 complex	IDA	21177249, 21376236, 21867682, 26263164, 28264193, 28968999, 29424687, 29567957, 33158864, 35926713
GO:0031932	Component	TORC2 complex	IEA
GO:0031932	Component	TORC2 complex	IPI	17461779
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0038203	Process	TORC2 signaling	IBA
GO:0038203	Process	TORC2 signaling	IDA	21177249, 21376236, 21806543, 26293922, 28264193, 28968999, 29424687, 29567957, 31130364, 33158864, 35926713
GO:0038203	Process	TORC2 signaling	IEA
GO:0038203	Process	TORC2 signaling	ISS
GO:0038203	Process	TORC2 signaling	ISS
GO:0043066	Process	Negative regulation of apoptotic process	NAS	22500797
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	17303383
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IMP	17303383
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IDA	18498745
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	9094314
GO:0060090	Function	Molecular adaptor activity	IDA	29567957
GO:0070300	Function	Phosphatidic acid binding	IDA	17303383
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IDA	17303383
GO:0140767	Function	Enzyme-substrate adaptor activity	IDA	21806543, 28264193, 35926713
GO:0140767	Function	Enzyme-substrate adaptor activity	IEA
GO:0140767	Function	Enzyme-substrate adaptor activity	ISS
GO:1900407	Process	Regulation of cellular response to oxidative stress	IEA
GO:1902554	Component	Serine/threonine protein kinase complex	IDA	35926713

MIM	HGNC	e!Ensembl
610558	18752	ENSG00000119487

Protein

UniProt ID

Q9BPZ7

Protein name

Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1)

Protein function

Component of the mechanistic target of rapamycin complex 2 (mTORC2), which transduces signals from growth factors to pathways involved in proliferation, cytoskeletal organization, lipogenesis and anabolic output (PubMed:15467718, PubMed:16919458

PDB

3VOQ , 5ZCS , 6ZWM , 6ZWO , 7LC1 , 7LC2 , 7PE7 , 7PE8 , 7PE9 , 7TZO , 7VV8 , 7VV9 , 7VVB , 7VVG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05422	SIN1	18 → 129	Stress-activated map kinase interacting protein 1 (SIN1)	Family
PF16978	CRIM	139 → 276	SAPK-interacting protein 1 (Sin1), middle CRIM domain	Family
PF16979	SIN1_PH	381 → 488	SAPK-interacting protein 1 (Sin1), Pleckstrin-homology	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in heart and skeletal muscle. {ECO:0000269|PubMed:15988011}.

Sequence

MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGE
TQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQEL
KSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVY
LPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGE
VDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVT
MKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRAD
GVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS
TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVL
KVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ

Sequence length

522

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway		PIP3 activates AKT signaling CD28 dependent PI3K/Akt signaling VEGFR2 mediated vascular permeability Constitutive Signaling by AKT1 E17K in Cancer Regulation of TP53 Degradation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidosis Lactic	Associate	15969653
Brain Diseases	Associate	15969653
Carcinogenesis	Associate	24161930, 31773361
Carcinogenesis	Inhibit	24161930
Carcinoma Squamous Cell	Associate	24926550
Drug Related Side Effects and Adverse Reactions	Stimulate	15969653
Fibrosis	Associate	30217824
Glioma	Associate	31773361
Influenza Human	Stimulate	9064338
MELAS Syndrome	Associate	15969653
Migraine Disorders	Associate	28208835
Mitochondrial Diseases	Associate	20185557
Mitochondrial Myopathies	Associate	15969653
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	20185557
Neoplasms	Associate	24161930
Neoplasms	Inhibit	31773361
Pulmonary Disease Chronic Obstructive	Associate	39223457

MAPKAP1 (MAPK associated protein 1)