Gene Gene information from NCBI Gene database.
Entrez ID 79018
Gene name GID complex subunit 4 homolog
Gene symbol GID4
Synonyms (NCBI Gene)
C17orf39VID2VID24
Chromosome 17
Chromosome location 17p11.2|17p11.2
Summary The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located wit
miRNA miRNA information provided by mirtarbase database.
1163
miRTarBase ID miRNA Experiments Reference
MIRT016107 hsa-miR-421 Sequencing 20371350
MIRT029028 hsa-miR-26b-5p Microarray 19088304
MIRT030790 hsa-miR-21-5p Microarray 18591254
MIRT039248 hsa-miR-454-3p CLASH 23622248
MIRT612973 hsa-miR-183-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 29911972
GO:0005829 Component Cytosol TAS
GO:0043161 Process Proteasome-mediated ubiquitin-dependent protein catabolic process IBA
GO:0061630 Function Ubiquitin protein ligase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617699 28453 ENSG00000141034
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IVV7
Protein name Glucose-induced degradation protein 4 homolog (Vacuolar import and degradation protein 24 homolog)
Protein function Substrate-recognition subunit of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (Probable) (PubMed:29
PDB 6CCR , 6CCT , 6CCU , 6CD8 , 6CD9 , 6CDC , 6CDG , 6WZX , 6WZZ , 7NSC , 7Q4Y , 7Q50 , 7SLZ , 7U3E , 7U3F , 7U3G , 7U3H , 7U3I , 7U3J , 7U3K , 7U3L , 8V1P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09783 Vac_ImportDeg 121 289 Vacuolar import and degradation protein Family
Sequence
MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATL
LGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATS
LLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEII
SKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL
VPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHV
PEHSAPIYEFR
Sequence length 300
Interactions View interactions