Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79018
Gene name Gene Name - the full gene name approved by the HGNC.
GID complex subunit 4 homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GID4
Synonyms (NCBI Gene) Gene synonyms aliases
C17orf39, VID2, VID24
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2|17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located wit
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016107 hsa-miR-421 Sequencing 20371350
MIRT029028 hsa-miR-26b-5p Microarray 19088304
MIRT030790 hsa-miR-21-5p Microarray 18591254
MIRT039248 hsa-miR-454-3p CLASH 23622248
MIRT612973 hsa-miR-183-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 29911972
GO:0005829 Component Cytosol TAS
GO:0043161 Process Proteasome-mediated ubiquitin-dependent protein catabolic process IBA
GO:0061630 Function Ubiquitin protein ligase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617699 28453 ENSG00000141034
Protein
UniProt ID Q8IVV7
Protein name Glucose-induced degradation protein 4 homolog (Vacuolar import and degradation protein 24 homolog)
Protein function Substrate-recognition subunit of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (Probable) (PubMed:29
PDB 6CCR , 6CCT , 6CCU , 6CD8 , 6CD9 , 6CDC , 6CDG , 6WZX , 6WZZ , 7NSC , 7Q4Y , 7Q50 , 7SLZ , 7U3E , 7U3F , 7U3G , 7U3H , 7U3I , 7U3J , 7U3K , 7U3L , 8V1P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09783 Vac_ImportDeg 121 289 Vacuolar import and degradation protein Family
Sequence
MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATL
LGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATS
LLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEII
SKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL
VPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHV
PEHSAPIYEFR
Sequence length 300
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Osteosarcoma Associate 22292074