Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	78996
Gene name Gene Name - the full gene name approved by the HGNC.	Cell cycle regulator of NHEJ
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYREN
Synonyms (NCBI Gene) Gene synonyms aliases	C7orf49, CYREN-1, CYREN-2, MRI, MRI-2
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q33

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003684	Function	Damaged DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	24610814, 28959974, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24610814
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	24610814
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IBA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IDA	24610814
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0033152	Process	Immunoglobulin V(D)J recombination	IEA
GO:0033152	Process	Immunoglobulin V(D)J recombination	ISS
GO:0035861	Component	Site of double-strand break	IEA
GO:0035861	Component	Site of double-strand break	ISS
GO:1990166	Process	Protein localization to site of double-strand break	IEA
GO:1990391	Component	DNA repair complex	IEA
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IDA	28959974
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IEA
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IEA

MIM	HGNC	e!Ensembl
616980	22432	ENSG00000122783

Protein

UniProt ID

Q9BWK5

Protein name

Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)

Protein function

Cell-cycle-specific regulator of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair, which can act both as an activator or inhibitor of NHEJ, depending on the cell cycle phase (PubMed:24610814, PubMed:28959974).

PDB

6TYU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15325	MRI	52 → 157	Modulator of retrovirus infection	Family

Sequence

METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAE
IVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAP
GLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS

Sequence length

157

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Prostate cancer	Prostate cancer (late onset)	N/A	N/A	GWAS

CYREN (cell cycle regulator of NHEJ)