Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7852
Gene name Gene Name - the full gene name approved by the HGNC.	C-X-C motif chemokine receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CXCR4
Synonyms (NCBI Gene) Gene synonyms aliases	CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS, WHIMS1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in

Show/Hide all(73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000006	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18568019
MIRT000635	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	20023705
MIRT006668	hsa-miR-150-5p	FACS, Western blot	22039399
MIRT000006	hsa-miR-146a-5p	Microarray	20375304
MIRT030235	hsa-miR-26b-5p	Microarray	19088304
MIRT054160	hsa-miR-139-5p	ChIP-seq, Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21925125
MIRT054160	hsa-miR-139-5p	ChIP-seq, Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21925125
MIRT054425	hsa-miR-126-3p	qRT-PCR, Western blot	24532280
MIRT054715	hsa-miR-9-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	24318902
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT438701	hsa-miR-494-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24644030
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT438701	hsa-miR-494-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24644030
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT731652	hsa-miR-622	ChIP-seq, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT731652	hsa-miR-622	ChIP-seq, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT731652	hsa-miR-622	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT731652	hsa-miR-622	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26082201
MIRT731652	hsa-miR-622	Luciferase reporter assay, qRT-PCR, Western blot	26082201
MIRT733087	hsa-miR-381-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, In situ hybridization	31815619
MIRT733087	hsa-miR-381-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32016478
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blotting	32635336
MIRT734511	hsa-miR-330-5p	Western blotting	32665904
MIRT734526	hsa-miR-143-3p	qRT-PCR	32449873
MIRT734935	hsa-miR-148a-3p	RNA-seq, Flow cytometry, ELISA	33336366
MIRT736049	hsa-miR-140-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32101839
MIRT054160	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	34070538
MIRT737210	hsa-miR-127-5p	Western blotting, RNA-seq, Immunofluorescence, ELISA	31719921
MIRT737311	hsa-miR-204-3p	Luciferase reporter assay, qRT-PCR	32521912
MIRT000006	hsa-miR-146a-5p	Western blotting, qRT-PCR	37095967
MIRT756120	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, RNA-seq, ChIP-seq, Flow cytometry	36597126
MIRT000006	hsa-miR-146a-5p	qRT-PCR	36415628
MIRT918223	hsa-miR-1910	CLIP-seq
MIRT918224	hsa-miR-204	CLIP-seq
MIRT918225	hsa-miR-211	CLIP-seq
MIRT918226	hsa-miR-3120-3p	CLIP-seq
MIRT918227	hsa-miR-3148	CLIP-seq
MIRT918228	hsa-miR-3187-3p	CLIP-seq
MIRT918229	hsa-miR-3653	CLIP-seq
MIRT918230	hsa-miR-3658	CLIP-seq
MIRT918231	hsa-miR-4435	CLIP-seq
MIRT918232	hsa-miR-4511	CLIP-seq
MIRT918233	hsa-miR-4681	CLIP-seq
MIRT918234	hsa-miR-4701-5p	CLIP-seq
MIRT918235	hsa-miR-4755-5p	CLIP-seq
MIRT918236	hsa-miR-4773	CLIP-seq
MIRT918237	hsa-miR-548b-3p	CLIP-seq
MIRT918238	hsa-miR-548s	CLIP-seq
MIRT918239	hsa-miR-588	CLIP-seq
MIRT918240	hsa-miR-623	CLIP-seq

Transcription factors

Show/Hide all(27)

Transcription factor	Regulation	Reference
CREB1	Unknown	11874984
CREB3	Activation	20473547
DNMT1	Repression	19932585
ERG	Activation	19396168;23918819
ETS1	Unknown	21741415
FOXO1	Activation	20068066
HDAC3	Repression	20473547
HIF1A	Activation	17075581
HIF1A	Unknown	19212630
IRF2	Repression	21447649
KLF2	Repression	19671192
KLF5	Activation	19460858
MYC	Activation	10229837
NFKB1	Activation	12690099;20068066
NFKB1	Unknown	20157762
NRF1	Activation	10381170;20068066
PAX3	Activation	20068066
RELA	Activation	12690099;16267013;20068066
RELA	Unknown	20157762
SNAI2	Activation	22074556
USF1	Activation	10229837
USF2	Activation	10229837
VHL	Repression	13679920
YBX1	Activation	17072343
YY1	Repression	10229837;11145693;12571248;15737629;15805285;20068066
YY1	Unknown	14563373
ZBTB16	Activation	18568019

Show/Hide all(77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	TAS	10228019
GO:0001666	Process	Response to hypoxia	IEP	15174142
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0003779	Function	Actin binding	IDA	12421915
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8276799
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	10644702, 12421915, 15660419, 17077324, 18632580, 18765807, 19106094, 19380869, 19665027, 20215400, 20802527, 21730065, 23170857, 23773523, 23926103, 24094005, 25775528, 27331810, 28862946, 28978524, 29386406, 34927784
GO:0005737	Component	Cytoplasm	TAS	10415069
GO:0005764	Component	Lysosome	IDA	24790097
GO:0005764	Component	Lysosome	IDA	21540189
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	24790097
GO:0005769	Component	Early endosome	IDA	21540189
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IDA	21540189
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	19665027, 21540189
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10393923
GO:0006915	Process	Apoptotic process	TAS	10942389
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	TAS	8276799
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	10644702
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	39093700
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007420	Process	Brain development	IBA
GO:0009615	Process	Response to virus	TAS	10583963
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	10521508, 10644702, 18308860, 19106094, 19665027, 23620790
GO:0015026	Function	Coreceptor activity	TAS	10754293
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016494	Function	C-X-C chemokine receptor activity	IDA	8752281
GO:0016494	Function	C-X-C chemokine receptor activity	NAS	9468539
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IMP	19064997
GO:0019955	Function	Cytokine binding	IEA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019957	Function	C-C chemokine binding	IPI	25612609
GO:0022008	Process	Neurogenesis	IBA
GO:0030155	Process	Regulation of cell adhesion	IDA	19703720
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	20023705
GO:0031252	Component	Cell leading edge	IDA	12421915
GO:0031410	Component	Cytoplasmic vesicle	IDA	10521508, 19106094
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19116316
GO:0032027	Function	Myosin light chain binding	IDA	12421915
GO:0032991	Component	Protein-containing complex	IDA	19665027
GO:0032991	Component	Protein-containing complex	IMP	25612609
GO:0038147	Function	C-X-C motif chemokine 12 receptor activity	IDA	28978524, 39093700
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IDA	28978524, 39093700
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IGI	27693460
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IMP	24912431
GO:0043130	Function	Ubiquitin binding	IDA	20228059
GO:0043217	Process	Myelin maintenance	ISS
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0060326	Process	Cell chemotaxis	IDA	19106094
GO:0060326	Process	Cell chemotaxis	IMP	19106094
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	21540189
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25016030
GO:1904018	Process	Positive regulation of vasculature development	IMP	27693460
GO:2000448	Process	Positive regulation of macrophage migration inhibitory factor signaling pathway	IMP	19665027

MIM	HGNC	e!Ensembl
162643	2561	ENSG00000121966

Protein

UniProt ID

P61073

Protein name

C-X-C chemokine receptor type 4 (CXC-R4) (CXCR-4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte-derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide-associated protein 3) (LAP-3) (LPS-associated protein 3) (NPYRL) (Stromal cell-derived facto

Protein function

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation (PubMed:10452968, PubMed:18799424, PubMed:24912431, PubMed:28978524). Involved in the AKT

PDB

2K03 , 2K04 , 2K05 , 2N55 , 3ODU , 3OE0 , 3OE6 , 3OE8 , 3OE9 , 4RWS , 8GP3 , 8I0Q , 8K3Z , 8U4N , 8U4O , 8U4P , 8U4Q , 8U4R , 8U4S , 8U4T , 8YU7 , 8ZPL , 8ZPM , 8ZPN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12109	CXCR4_N	6 → 38	CXCR4 Chemokine receptor N terminal	Domain
PF00001	7tm_1	55 → 302	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astro

Sequence

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Virion - Human immunodeficiency virus Calcium signaling pathway Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Endocytosis Axon guidance Leukocyte transendothelial migration Intestinal immune network for IgA production Regulation of actin cytoskeleton Human cytomegalovirus infection Human immunodeficiency virus 1 infection Pathways in cancer		Binding and entry of HIV virion Signaling by ROBO receptors Chemokine receptors bind chemokines G alpha (i) signalling events

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Immunodeficiency	Inherited Immunodeficiency Diseases	rs1573613529	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Triple-negative breast cancer	The knockout of the CXCR4 and CXCR7 genes affects the binding capacity and functions of CXCL12, inhibits the malignant progression of TNBC cells significantly, and may become a potential target for the treatment of TNBC.	31190884	CBGDA
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (467)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Achalasia Addisonianism Alacrimia syndrome	Stimulate	36519232
Achondroplasia	Associate	28729430
Acquired Immunodeficiency Syndrome	Associate	10364306, 12500303, 14645592, 16877302, 17251288, 17360650, 19058828, 22845664, 22962615, 23133358, 23617327, 24750723, 26083631, 37939456, 9226150
ACTH Secreting Pituitary Adenoma	Stimulate	18698020
Acute Disease	Associate	36536281
Acute Kidney Injury	Associate	34826532
Acute Lung Injury	Associate	29566745
Adenocarcinoma	Associate	17082613, 17176471, 17504381
Adenocarcinoma of Lung	Associate	17082613, 19258077, 26338423, 33637678, 36308553, 38204755
Adenocarcinoma of Lung	Inhibit	35768814
Adenoma	Associate	18698020, 20865359
Adenoma Chromophobe	Associate	22245330
Adenoma Oxyphilic	Associate	22245330, 36982302
Adenomatous Polyps	Associate	15592929
Adrenocortical Carcinoma	Associate	33281749
Agammaglobulinemia	Associate	15026312, 17270027, 18556651, 20148920, 20226738, 33415666, 33485325, 35588454
AIDS Dementia Complex	Associate	9327737
Alcoholism	Associate	21121937
Altitude Sickness	Associate	32033172
Alveolar capillary dysplasia	Associate	35649494
Alzheimer Disease	Associate	17188679, 23824053, 36569892
Alzheimer Disease	Inhibit	30080220, 37801139
Amyloidosis	Associate	31780812
Amyotrophic Lateral Sclerosis	Stimulate	29592817
Anemia Aplastic	Associate	22797698, 28831064
Anemia Refractory	Associate	19692701
Anemia Sickle Cell	Associate	32868775
Anterior Wall Myocardial Infarction	Associate	28775206
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	37137530
Aortic Aneurysm	Associate	36519232
Aortic Aneurysm Abdominal	Associate	26346005
Aortic Aneurysm Abdominal	Stimulate	36519232
Arthritis	Associate	27005825, 28619088, 29880013
Arthritis Juvenile	Associate	27005825
Arthritis Psoriatic	Stimulate	32733468
Arthritis Rheumatoid	Associate	10323455, 11817585, 15382150, 16507142, 17082220, 19538721, 19804625, 20738854, 22275188, 27385284, 27411480, 31729947, 32111105, 32264938, 33042152, 34484236 View all (1 more)
Arthritis Rheumatoid	Inhibit	24433281
Arthritis Rheumatoid	Stimulate	31081041, 35095831
Ascites	Associate	17926037
Asthma	Associate	15788997, 19223978, 36197221
Astrocytoma	Associate	19336886, 22086906, 24970694
Ataxia	Associate	30819232
Ataxia Telangiectasia	Associate	32166899
Atherosclerosis	Associate	24423463, 28775206, 28932900, 29967943, 30520941, 31004184, 31653710, 32787365, 35055054, 36094626, 36519232
Atrial Fibrillation	Associate	19761697, 30760287, 32383373, 32682418, 33755965, 35919038, 36042613
Atrial Fibrillation	Stimulate	35607269
Atrial Remodeling	Associate	19761697
Autoimmune Diseases	Associate	22367177, 23764537, 27005825, 30018141, 30827936, 35908411, 37388364
Autoimmune Lymphoproliferative Syndrome	Associate	31714901
Bacterial Infections	Associate	23009155
Bipolar Disorder	Associate	25733313
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Blood Platelet Disorders	Associate	10666407
Bone Diseases	Associate	19237480, 21741415, 28143986, 39503766
Bone Marrow Diseases	Associate	22936065, 24553177, 24651452, 27301862, 31554271, 34289017, 36210485
Bone Neoplasms	Stimulate	18337451
Brain Neoplasms	Associate	19625779, 24934367, 25227814, 26000059, 26689941, 29696364, 29849822, 32410920
Brain Neoplasms	Stimulate	19739271, 22430135, 28952213
Breast Diseases	Associate	28454081
Breast Neoplasms	Associate	12370187, 12433920, 12927045, 13679920, 15033669, 15542424, 15739262, 16457694, 16627550, 16740704, 16863915, 17351259, 17699109, 18083706, 18670789 View all (82 more)
Breast Neoplasms	Stimulate	23827153, 32702599
Breast Neoplasms Male	Associate	32188473
Burkitt Lymphoma	Associate	21672222
Calcinosis Cutis	Stimulate	16528367, 23401071, 29112684
Calcinosis Cutis	Associate	19237480, 19325708, 19939894, 21672222, 28356064, 35259193
Cap Myopathy	Associate	24970800
Carcinogenesis	Associate	21076047, 23468933, 25114911, 25400739, 26404566, 26576337, 26823797, 29745083, 31011147, 31534521, 35083551, 36564369
Carcinoma	Associate	22916293, 35799158
Carcinoma Basal Cell	Associate	21521526, 23009155, 24398989, 25301050
Carcinoma Ductal	Stimulate	26744317
Carcinoma Hepatocellular	Associate	12149145, 12651617, 16819541, 17075975, 17259344, 18954561, 19508713, 21110890, 21909361, 24614035, 25363530, 26404566, 28102846, 28584306, 29391759 View all (7 more)
Carcinoma in Situ	Associate	23495012, 26415052
Carcinoma Lobular	Associate	19583841
Carcinoma Merkel Cell	Associate	22814318
Carcinoma Neuroendocrine	Associate	34609417
Carcinoma Non Small Cell Lung	Associate	15033669, 15802268, 19258077, 19309748, 19563666, 21623238, 22430135, 23192271, 25592377, 28925100, 29032612, 29745083, 32495879, 33123122, 33507926, 34603645, 36308553 View all (2 more)
Carcinoma Ovarian Epithelial	Associate	17926037, 20460402, 21527066, 24209634, 33676525, 34916377, 35545781
Carcinoma Pancreatic Ductal	Associate	23650783, 25679210, 35797269, 36112544, 36142575, 37697316, 38471128, 40019403, 40269781
Carcinoma Renal Cell	Associate	13679920, 22471472, 23039915, 24327013, 24714746, 27279483, 28923105, 31850854, 32775427, 34266404, 34449964, 35259193, 36982302, 37010151
Carcinoma Renal Cell	Inhibit	27638770
Carcinoma Renal Cell	Stimulate	33827033
Carcinoma Squamous Cell	Associate	18310089, 18505078, 35358193, 36308553
Cardiovascular Diseases	Associate	12697743, 14990582, 18286257, 28775206, 29967943, 30520941
Carotid Artery Diseases	Associate	34140767
Carotid Stenosis	Associate	31004184, 32037372, 33319833
Cartilage Diseases	Associate	11817585, 18205922, 27356492, 33773470
Cell Transformation Neoplastic	Stimulate	33966046
Cell Transformation Neoplastic	Associate	37838700
Cerebellar Diseases	Associate	30819232
Chagas Cardiomyopathy	Associate	29160519
Cholangiocarcinoma	Associate	16565491, 17461449, 22664794, 27809873, 29282035
Cholangitis Sclerosing	Associate	17328838, 28383652
Chondrosarcoma	Associate	20102637, 21631268, 26013170
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	35045088
Chromosome Aberrations	Associate	15781337
Chronic Limb Threatening Ischemia	Associate	20206813
Clear cell metastatic renal cell carcinoma	Associate	27279483
Cleft Lip	Associate	19287188
Coinfection	Associate	36443691
Colitis Ulcerative	Stimulate	21087446
Colonic Neoplasms	Stimulate	20865359
Colonic Neoplasms	Associate	31073530
Colorectal Neoplasms	Associate	15592929, 16641550, 16794396, 18416455, 18443596, 18959627, 19568410, 20798912, 20865359, 20953377, 21349176, 21350711, 23071744, 23098564, 24330809 View all (24 more)
Common Variable Immunodeficiency	Associate	33859323
Communicable Diseases	Associate	18556651, 28729430
Congenital Abnormalities	Associate	30819232
Conjunctivitis Allergic	Associate	11673306
Corneal Neovascularization	Associate	26727921
Coronary Artery Disease	Associate	25660395, 29967943, 31886261, 34552562
Coronary Disease	Associate	32016478
Corticobasal Degeneration	Associate	28271184
COVID 19	Associate	33784417, 34116286, 34153417, 34548411, 35002537, 37291167
COVID 19	Stimulate	37946732
Craniopharyngioma	Associate	24934367
Crohn Disease	Associate	25892890
Cytokine Release Syndrome	Stimulate	29414810
Death	Stimulate	17351259, 37666354
Death	Associate	22220212, 24859274, 25347450, 25660395, 25679210, 28790053
Dementia	Associate	11115360, 32303038
Dental Plaque	Associate	28775206
Dentin dysplasia sclerotic bones	Associate	17515952
Dermatitis Atopic	Associate	15788997, 36142206
Desmoplastic Small Round Cell Tumor	Associate	37348915
Diabetes Complications	Associate	18286257
Diabetes Mellitus	Inhibit	18286257, 30184318, 30321232
Diabetes Mellitus Type 1	Associate	34267242
Diabetes Mellitus Type 2	Associate	18286257, 18461161
Diabetic Foot	Associate	39991734
Diabetic Nephropathies	Associate	29207157, 38206700, 39512693
Disease	Associate	23543442
Drug Related Side Effects and Adverse Reactions	Associate	21045835, 30080220
Dry Eye Syndromes	Stimulate	29673232
Dyskinesia Familial with Facial Myokymia	Associate	30636773
Encephalitis Tick Borne	Associate	26906062
Endometrial Neoplasms	Associate	22025313, 24416254, 26678890
Endometriosis	Associate	20720261, 27323121, 27729562, 29161347
Endotoxemia	Associate	11023494
Epilepsy Partial with Variable Foci	Associate	19325708
Epstein Barr Virus Infections	Associate	16476057
Epstein Barr Virus Infections	Stimulate	33052232
Esophageal Neoplasms	Associate	17171785, 17176471, 24074251, 27041792, 28467773, 33579381
Esophageal Squamous Cell Carcinoma	Associate	12901795, 17176471, 19550128, 23497377, 26092504
Exanthema	Associate	34289017
Fatigue Syndrome Chronic	Associate	24054763
Fatty Liver Alcoholic	Associate	24997224
Feline Panleukopenia	Associate	21890643, 30625055
Fibrocartilaginous embolism	Associate	27163878, 27220474
Fibrosis	Associate	29566745, 32440550, 36091020
Gallbladder Neoplasms	Associate	21986127, 32512633
Gastritis	Associate	22936065
Gastro enteropancreatic neuroendocrine tumor	Associate	26259237, 30867449
Gastrointestinal Neoplasms	Associate	19568410, 34484469, 34609417
Gastrointestinal Stromal Tumors	Associate	39464891
Genetic Diseases Inborn	Associate	16899028, 23734232
Genetic Predisposition to Disease	Associate	15536153
Genital Neoplasms Female	Associate	21527066
Geographic Atrophy	Associate	38165703
Gingival Diseases	Associate	33934404
Gingivitis	Stimulate	37986309
Glaucoma	Stimulate	26275042
Glaucoma Open Angle	Stimulate	26275042
Glioblastoma	Associate	12761880, 17075581, 18083706, 18812968, 19008040, 19923906, 22427929, 24023874, 25860928, 26909116, 28040478, 28423060, 30467961, 32632898, 33550492, 33596115, 35464424, 39300240 View all (3 more)
Glioblastoma	Stimulate	21084856, 26608373, 37757768, 39690071
Glioma	Associate	12388552, 16760646, 17066899, 17075581, 17404502, 18812968, 19008040, 19336886, 19923906, 20157762, 21084856, 23865743, 24050252, 24150861, 24249397 View all (9 more)
Glioma	Stimulate	22086906
Glucose Intolerance	Inhibit	25303939
Glycogen Storage Disease Type IV	Associate	33507926
Graft vs Host Disease	Associate	20025985, 24621606, 34539656
Granulomatosis with Polyangiitis	Associate	28615072
Granulomatous Disease Chronic	Associate	12414528
Graves Disease	Associate	19897675, 24684463, 27471912
Graves Ophthalmopathy	Associate	27471912
Heart Defects Congenital	Associate	30819232
Heart Diseases	Associate	30819232
Heart Failure	Associate	38065888, 38169915
Hemangioblastoma	Associate	17070589, 26920352
Hemangiosarcoma	Associate	40474296
Hematologic Diseases	Associate	24500843
Hematologic Neoplasms	Associate	21443538, 34049979
Hemorrhage	Associate	25853747
Hepatitis B	Associate	15048728
Hepatitis C	Associate	15048728, 20710056
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12761880, 25753200, 32393308
Hermanski Pudlak Syndrome	Associate	25347450
HIV Infections	Associate	10497106, 10540164, 11023494, 11032864, 11115360, 11157475, 11278278, 12709027, 14630801, 14764521, 15196257, 15479822, 16014924, 16928758, 16943296 View all (38 more)
HIV Seropositivity	Associate	37979093
Hodgkin Disease	Associate	11830455, 18488221
HTLV I Infections	Associate	10982382, 11150506, 11507184, 11861874, 12489987, 12805470, 14645592, 15857992, 15994814, 16641282, 18784079, 21731496, 24041034, 25265194, 29141633, 9499040 View all (1 more)
Hyperaldosteronism	Associate	29279316, 39659571
Hyperglycemia	Stimulate	26010611
Hyperglycemia	Inhibit	31018749, 34639171
Hypoxia	Stimulate	15802268, 16929169, 17075581, 17442415, 17594938, 20068066, 20102637, 20151982, 21521526, 22767589, 24618817, 24629239, 24651452, 26013170, 26045293 View all (6 more)
Hypoxia	Associate	20157762, 35942521, 35985446, 36214722, 39328420
Hypoxia Brain	Stimulate	13679920, 15802268, 17594938, 24126540, 24618817, 27356492, 30760238
Hypoxia Brain	Associate	26045293, 26599430, 28554530, 30781795, 35942521
Idiopathic Noncirrhotic Portal Hypertension	Associate	35726350
Idiopathic Pulmonary Fibrosis	Stimulate	20483575, 20646340
Idiopathic Pulmonary Fibrosis	Associate	21309737, 29507348, 32822674, 32843095
IgA Vasculitis	Associate	10323455, 15661933
IgA Vasculitis	Stimulate	32733468
Immunoglobulin G4 Related Disease	Associate	20068066, 35493524
Immunologic Deficiency Syndromes	Associate	18556651, 19250276, 20148920, 20226738, 26297538, 35493524, 9971817
Infections	Associate	10438841, 10482544, 10548593, 10864687, 11090186, 11119612, 11150506, 11287558, 11287575, 11668182, 11739668, 11884536, 12489987, 12610152, 14990692 View all (39 more)
Infections	Stimulate	11023494, 30559208, 32281423, 9557695
Infections	Inhibit	34906163
Inflammation	Associate	12688247, 12746476, 12829025, 12936978, 15265234, 15382150, 18155192, 18556651, 19139298, 19415545, 19538721, 20126412, 20646340, 22245330, 23734232 View all (33 more)
Inflammation	Stimulate	25503960, 32281423
Inflammatory Breast Neoplasms	Associate	17351259
Internal Hernia	Associate	30819232
Intervertebral Disc Degeneration	Associate	27220474, 31173219, 32901877
Intestinal Diseases	Associate	24373354
Intestinal Neoplasms	Associate	15867478, 20032431
Kashin Beck Disease	Associate	29317700
Keratoconjunctivitis	Associate	15788997
Kidney Diseases	Associate	34826532
Kidney Failure Chronic	Associate	15033669, 29868028
Kidney Neoplasms	Associate	11953881, 23192271, 24511119, 27638770, 36551144
Kidney Neoplasms	Stimulate	35226449
Klatskin Tumor	Stimulate	24672662
Laryngeal Neoplasms	Associate	26261502
Leprosy	Inhibit	22002092
Leprosy Tuberculoid	Inhibit	22002092
Leukemia	Associate	11023495, 11399509, 16888090, 18957686, 19789386, 20145264, 22613469, 23754844, 24500843, 26045293, 26806619, 27127886, 30208330, 31260716, 31518054, 32697348, 34619434, 39744224, 9616148 View all (4 more)
Leukemia B Cell	Associate	11160154, 24859274
Leukemia Erythroblastic Acute	Associate	15781337
Leukemia Hairy Cell	Associate	37137530
Leukemia Large Granular Lymphocytic	Associate	12614207, 17005036, 19251297
Leukemia Lymphocytic Chronic B Cell	Associate	10627472, 11023495, 15633209, 16840734, 17652619, 19789386, 19812382, 20145264, 20145270, 20661426, 21079155, 22058221, 24914134, 25544766, 26413812 View all (9 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	21865343, 23954894, 24637360
Leukemia Lymphoma Adult T Cell	Associate	37461070
Leukemia Monocytic Acute	Associate	26045293, 39207051
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	28103766
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	32075106
Leukemia Myeloid	Associate	17005036
Leukemia Myeloid Acute	Associate	12829025, 16888090, 17315232, 18957686, 20810927, 21456010, 23754844, 23798675, 24035716, 24500843, 25193961, 26045293, 26246143, 27258612, 27577048 View all (16 more)
Leukemia Myeloid Acute	Stimulate	24615181
Leukemia Myelomonocytic Acute	Associate	10997965
Leukemia Myelomonocytic Acute	Stimulate	31518054
Leukemia Prolymphocytic T Cell	Associate	27127886, 28419476, 29665227, 29978459
Leukemia Promyelocytic Acute	Associate	19291801
Leukemia T Cell	Associate	11736934, 12472574, 26082201
Leukemic Infiltration	Associate	11736934
Leukocytosis	Associate	24500843
Leukopenia	Associate	36089616
Lichen Planus Oral	Stimulate	32214134
Liver Cirrhosis	Associate	30239650
Liver Cirrhosis Biliary	Associate	33815355
Liver Diseases	Associate	12746476, 15048728, 37851406
Liver Failure	Stimulate	16627550
Liver Failure	Associate	35726350
Ludwig's Angina	Associate	21818756
Lung Diseases	Associate	24651452, 33123122
Lung Diseases Interstitial	Associate	25347450
Lung Injury	Associate	35583012
Lung Neoplasms	Associate	17113184, 25775124, 26338423, 26494555, 28925100, 29032612, 29171984, 29745083, 31287095, 32495879, 33123122, 33637678, 34107168, 37838700
Lupus Erythematosus Systemic	Inhibit	16802356, 23244336
Lupus Erythematosus Systemic	Associate	20722038, 23028528, 25986394, 27065298
Lupus Erythematosus Systemic	Stimulate	23764537, 27665947
Lupus Nephritis	Stimulate	27665947
Lupus Vasculitis Central Nervous System	Associate	20722038
Lymphadenopathy	Associate	24553177
Lymphatic Diseases	Associate	27127886
Lymphatic Metastasis	Associate	12927045, 15654831, 16819541, 17032700, 17504381, 18443596, 18505078, 18781098, 18826577, 19025611, 20032431, 20181250, 20953377, 21527066, 21633638 View all (22 more)
Lymphatic Metastasis	Stimulate	18670789, 19352387, 19550128, 30786682, 37530325
Lymphoma	Associate	19308288, 25704881, 25819228, 31378966, 31554271, 33208624, 36713377, 38036098
Lymphoma AIDS Related	Stimulate	39324141
Lymphoma B Cell	Associate	10627472, 11157475, 16476057, 22936065, 32332145
Lymphoma B Cell Marginal Zone	Associate	12507894, 22936065, 26659815, 31281504
Lymphoma Follicular	Associate	17198877
Lymphoma Large B Cell Diffuse	Associate	22722314, 22936065, 25378977, 25704881, 29920526, 31554271, 35794478
Lymphoma Large B Cell Diffuse	Stimulate	31471373
Lymphoma Mantle Cell	Associate	19228923, 26350264
Lymphoma Mantle Cell	Inhibit	23940282
Lymphoma Non Hodgkin	Associate	10887135, 24859274
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	19710685
Lymphoma T Cell	Associate	30018141
Lymphoma T Cell Cutaneous	Associate	25681335, 31358475
Lymphoma T Cell Peripheral	Associate	18277033
Lymphopenia	Associate	15528395, 34906163
Lymphoproliferative Disorders	Associate	18842429
Macular Degeneration	Associate	35352887
Medulloblastoma	Associate	23497290, 24997224, 35967388
Melanoma	Associate	11571298, 15033669, 16397238, 16794396, 16929176, 17594938, 19293150, 19779716, 20061818, 22220212, 24158781, 31324252, 36923305, 38070141, 39207051
Melanoma Cutaneous Malignant	Associate	17410362
Meningioma	Associate	17108064, 25227814
Meningitis Cryptococcal	Associate	29658309
Mesothelioma	Associate	21294125
Mesothelioma Malignant	Associate	19309551, 21294125, 37047331
Mitral Valve Stenosis	Associate	19761697
Monoclonal Gammopathy of Undetermined Significance	Associate	26659815, 36210485
Motor Skills Disorders	Associate	30819232
Mouth Diseases	Stimulate	20720261, 27729562
Mouth Diseases	Associate	29224811, 35154113
Mouth Neoplasms	Associate	25866764
Mucocutaneous Lymph Node Syndrome	Associate	35493524
Multiple Myeloma	Associate	11020354, 11154207, 12644822, 17686053, 21569821, 21912642, 23450831, 25526031, 26564323, 27769052, 28008160, 28042328, 28670693, 30781795, 35276027 View all (5 more)
Multiple Sclerosis	Associate	18276777, 19139298, 30160778, 31332391, 33574821, 33735664, 33795012
Muscular Dystrophy Duchenne	Associate	18493616, 32157826
Muscular Dystrophy Facioscapulohumeral	Associate	35621301
Myasthenia Gravis	Associate	22704519
Mycobacterium avium intracellulare Infection	Associate	20148920
Mycosis Fungoides	Associate	14708605
Myelodysplastic Syndromes	Associate	22889515, 32772642
Myocardial Infarction	Associate	29967943, 39198660
Myositis	Stimulate	35371068
Nasopharyngeal Carcinoma	Associate	18087217, 23472069, 23987636, 24877105, 26715277, 28559386, 32521912, 33122398, 36438903
Necrosis	Associate	17075581
Neoplasm Invasiveness	Associate	17699109, 23543442, 24672662, 34609417, 36617771
Neoplasm Metastasis	Associate	12239174, 13679920, 15033669, 15382150, 15542424, 15592929, 15654831, 15802268, 16528367, 16740704, 16794396, 16863915, 16929169, 16977794, 17032700 View all (136 more)
Neoplasm Metastasis	Stimulate	12927045, 16641550, 19508713, 19939894, 20865359, 20953377, 23075330, 23231927, 23827153, 26823791, 31524146
Neoplasms	Associate	11668182, 12149145, 12927045, 13679920, 15033669, 15382150, 15592929, 15654831, 15662133, 16528367, 16641550, 16751302, 16756721, 16794396, 16819541 View all (258 more)
Neoplasms	Stimulate	11953881, 12761880, 22220212, 23401071, 27638770, 31324252, 32896997, 38096163
Neoplasms	Inhibit	31242243, 32306562
Neoplasms Plasma Cell	Associate	31780812
Neoplasms Squamous Cell	Associate	25866764
Nerve Degeneration	Associate	16877302
Nervous System Diseases	Associate	23916293
Neuritis Autoimmune Experimental	Associate	37713206
Neuroblastoma	Associate	10820198, 16001969, 18083706, 20028517, 22916293, 24376734, 24452472, 25503960, 25527973, 25774696, 29051534, 35942521
Neurodegenerative Diseases	Associate	19106094, 33219123, 39991734
Neuroendocrine Tumors	Associate	28186979, 28529632
Neurofibrosarcoma	Associate	23434321, 28055968, 29020982
Neuromyelitis Optica	Stimulate	34465614
Neurotoxicity Syndromes	Associate	12768009
Neutropenia	Associate	19043667, 35493524, 35525891, 36883568
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	35525891
Neutrophil Immunodeficiency Syndrome	Associate	38204755
Obesity	Associate	23349771, 37063877
Oculocutaneous albinism type 2	Stimulate	10585143
Organizing Pneumonia	Associate	11736934
Osteoarthritis	Associate	11817585, 27356492, 30942441, 32101839, 37291167
Osteoarthritis Knee	Associate	32978834
Osteolysis	Associate	18337451
Osteosarcoma	Associate	24618817, 25890096, 26546437, 28468584, 29734183, 31983166, 38129870, 40699365
Ovarian Neoplasms	Associate	17459055, 20460402, 21115652, 21527066, 21738044, 22025564, 22200669, 22549810, 24408020, 25712684, 26819076, 32977853, 33829065, 35397601, 37644468
Ovarian Neoplasms	Stimulate	25514788
Overweight	Associate	23349771
Pancreatic Diseases	Associate	21045835
Pancreatic Intraductal Neoplasms	Associate	14982844
Pancreatic Neoplasms	Associate	12761880, 15662133, 17560257, 19002187, 19035451, 19352387, 20426768, 20798912, 21045835, 21448932, 22220212, 22377565, 22450749, 22472349, 22995914 View all (15 more)
Pancreatic Neoplasms	Stimulate	17012836, 31584877
Pancreatitis	Associate	20564084, 36142575
Papillomavirus Infections	Associate	35083551, 35154113
Paraparesis Tropical Spastic	Associate	24041428, 37461070
Paraproteinemias	Associate	28983055, 30026568, 37088135, 37137530
Parkinson Disease	Associate	34528139
Periodontal Diseases	Associate	16045736
Periodontitis	Associate	34859622, 36148415, 38206700
Peritoneal Neoplasms	Associate	19688824
Peritonitis	Associate	33655604
Persistent Infection	Associate	26436997, 28729430
Personality Disorders	Associate	31554271, 34588386, 35083551
Phyllodes Tumor	Stimulate	22203494
Pituitary Neoplasms	Associate	18698020, 23895705, 32224525
Plaque Atherosclerotic	Associate	31004184, 31653710
Pleural Effusion Malignant	Associate	26338423
Polycystic Kidney Autosomal Dominant	Associate	31186083
Polycystic Ovary Syndrome	Associate	35689735
Polycystic Ovary Syndrome	Stimulate	38243290
Polycythemia Vera	Associate	35771847
Polyps	Associate	15592929, 20109310
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	26436997
Pre Eclampsia	Stimulate	34301912
Precancerous Conditions	Stimulate	21045835
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Stimulate	10997965
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17005036, 21456010, 24697337, 35316324
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11736934, 12472574, 12899713, 18322253, 24697337, 26082201, 34396983, 36054080
Primary Immunodeficiency Diseases	Associate	33485325
Primary Myelofibrosis	Associate	22536419
Primary Myelofibrosis	Inhibit	26408680
Prodromal Symptoms	Associate	19779716
Prostatic Neoplasms	Associate	12761880, 15467730, 16756721, 16859559, 17034033, 18201276, 18337451, 18431597, 18452560, 18836306, 19460858, 21076047, 21156016, 21627959, 22074556 View all (16 more)
Prostatic Neoplasms Castration Resistant	Stimulate	21365123
Prostatitis	Associate	15802268, 16756721, 20972812, 21076047, 22245379, 23321466, 25884570, 27462860
Pulmonary Disease Chronic Obstructive	Stimulate	17050556, 37838700
Pulmonary Disease Chronic Obstructive	Associate	19218194, 23009155, 33116473
Pulmonary Disease Chronic Obstructive	Inhibit	24742278
Pulmonary edema of mountaineers	Associate	39328420
Pulmonary Fibrosis	Associate	20646340
Purpura Thrombocytopenic Idiopathic	Associate	18519809
Purpura Thrombotic Thrombocytopenic	Associate	24692066
Pyruvate Carboxylase Deficiency Disease	Associate	36752202
Rectal Neoplasms	Associate	19826039, 34108073
Renal Insufficiency	Associate	18820725
Renal Insufficiency Chronic	Associate	23663527, 25866451, 39253088
Retinal Dysplasia	Associate	35154113
Rhabdoid Tumor Predisposition Syndrome 1	Associate	26998479
Rhabdomyosarcoma	Associate	12239174, 20068066, 26037167
Rhabdomyosarcoma Alveolar	Stimulate	12239174
Rhabdomyosarcoma Alveolar	Associate	15184910
Rhinitis Allergic	Associate	33836777
Rigid spine syndrome	Associate	24997224
Roberts Syndrome	Associate	33319833
Sarcoidosis	Stimulate	20169144
Sarcoidosis Pulmonary	Associate	26696750
Sarcoma	Associate	18083706
Sarcoma Ewing	Associate	15183454, 20525755, 23075330, 24651452, 26428435, 28549419, 29776413, 31810195
Sarcoma Kaposi	Associate	15110993
Sarcoma Myeloid	Associate	11736934, 25833301
Sarcoma Synovial	Associate	25613038
Scleroderma Systemic	Associate	24578173, 25986394, 29566745
Seminoma	Associate	23495012, 32615059
Sepsis	Associate	35583012
Sertoli Cell Only Syndrome	Associate	25704881
Severe Acute Respiratory Syndrome	Inhibit	34906163
Severe combined immunodeficiency due to adenosine deaminase deficiency	Associate	24465884
Sezary Syndrome	Associate	16204308, 28694325, 31106661
Sick Sinus Syndrome	Stimulate	36171622
Sjogren's Syndrome	Stimulate	15986367
Skin Diseases	Associate	31287410
Sleep Apnea Obstructive	Associate	33243845
Small Cell Lung Carcinoma	Stimulate	25671300
Small Cell Lung Carcinoma	Associate	26823791, 26843617, 28299514
Smoke Inhalation Injury	Associate	32929038
Splenomegaly	Associate	24500843
Spondylitis Ankylosing	Associate	25506924, 25853812
Squamous Cell Carcinoma of Head and Neck	Associate	18781098, 20695076, 21205837, 22384257, 26232325, 31263828, 33655604, 34741382, 35309836, 35978426, 36300800, 36834729
Squamous Cell Carcinoma of Head and Neck	Inhibit	25866764
Squamous Cell Carcinoma of Head and Neck	Stimulate	38096163
Squamous Intraepithelial Lesions	Associate	35083551
ST Elevation Myocardial Infarction	Associate	29967943
Still's Disease Adult Onset	Associate	31287410
Stomach Neoplasms	Associate	15654831, 15867478, 19688824, 20032431, 20386750, 21443538, 21633638, 21880153, 22337890, 23936528, 24312338, 24929539, 25400739, 26823797, 28489887 View all (15 more)
Stroke	Associate	30760287
Supranuclear Palsy Progressive	Associate	28271184, 35842134
Syndrome	Associate	24553177, 25514788
Synovitis	Associate	29968759
Synovitis Pigmented Villonodular	Associate	16508983
T Lymphocytopenia	Associate	20038787
T Lymphocytopenia Idiopathic CD4 Positive	Associate	20038787
Tarlov Cysts	Associate	24998559
Telangiectasia Hereditary Hemorrhagic	Associate	34906163
Tertiary Lymphoid Structures	Associate	17504381, 20953377, 30786682
Tertiary Lymphoid Structures	Stimulate	24375039
Thrombocythemia Essential	Inhibit	19006565
Thrombocytopenia	Associate	24035716, 34289017
Thrombosis	Associate	21110890
Thymus Neoplasms	Associate	12072494
Thyroid cancer medullary	Associate	29112684
Thyroid Cancer Papillary	Stimulate	16203990, 20306451
Thyroid Cancer Papillary	Associate	18826577, 21909080, 23918302, 24288553, 25326811, 27082011, 33522355, 34588386, 35786050, 36512648
Thyroid Neoplasms	Associate	21909080, 27082011, 35799158, 36419107, 39187346
Thyroiditis	Associate	11966764, 39187346
Tooth Erosion	Associate	19538721
Triple Negative Breast Neoplasms	Associate	24356721, 31924747, 36209974, 38111587
Triple Negative Breast Neoplasms	Stimulate	34224371
Tuberculosis Extrapulmonary	Associate	19538721
Tuberculosis Meningeal	Associate	21818756
Tuberculosis Pulmonary	Associate	15730395
Urinary Bladder Neoplasms	Associate	22736438, 23526079, 23886194, 32228629
Uterine Cervical Dysplasia	Associate	22958742
Uterine Cervical Neoplasms	Associate	16977794, 17032700, 19308288, 19574782, 22958742, 25114911, 35083551
Uveal melanoma	Associate	17410362, 20036848, 23164171, 26490988
Uveitis	Associate	37042831
Vascular System Injuries	Associate	10942389
Vasospasm Intracranial	Associate	31595394
Ventricular Remodeling	Associate	28716707
Vipoma	Associate	23231927
Virus Diseases	Associate	10208936, 10220446, 16079584, 16109172, 30285606, 37388364
Voice Disorders	Associate	30819232
von Hippel Lindau Disease	Inhibit	13679920
von Hippel Lindau Disease	Associate	17070589
Waldenstrom Macroglobulinemia	Associate	18448868, 21106070, 24366360, 24553177, 24786453, 25371371, 25853747, 25893290, 26002963, 26659815, 27301862, 28235842, 28548645, 28983055, 30183082 View all (14 more)
Warts	Associate	15026312, 15536153, 16899028, 17270027, 18556651, 20148920, 20226738, 23009155, 25819228, 33415666, 35154113, 35588454, 35947323
WHIM syndrome	Associate	15026312, 15536153, 15781337, 16899028, 17270027, 18436740, 18556651, 19043667, 19956569, 20148920, 20226738, 20736454, 21890643, 22596258, 23009155 View all (26 more)
Wounds and Injuries	Inhibit	26303896
X Linked Combined Immunodeficiency Diseases	Associate	35493524

CXCR4 (C-X-C motif chemokine receptor 4)