Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7805
Gene name Gene Name - the full gene name approved by the HGNC.	Lysosomal protein transmembrane 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LAPTM5
Synonyms (NCBI Gene) Gene synonyms aliases	CLAST6
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p35.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. [provided by RefSeq, Feb 2009]

Show/Hide all(69)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018494	hsa-miR-335-5p	Microarray	18185580
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT1104156	hsa-miR-1269	CLIP-seq
MIRT1104157	hsa-miR-1269b	CLIP-seq
MIRT1104158	hsa-miR-1288	CLIP-seq
MIRT1104159	hsa-miR-22	CLIP-seq
MIRT1104160	hsa-miR-2355-5p	CLIP-seq
MIRT1104161	hsa-miR-3064-3p	CLIP-seq
MIRT1104162	hsa-miR-3176	CLIP-seq
MIRT1104163	hsa-miR-3545-3p	CLIP-seq
MIRT1104164	hsa-miR-3922-3p	CLIP-seq
MIRT1104165	hsa-miR-4515	CLIP-seq
MIRT1104166	hsa-miR-4539	CLIP-seq
MIRT1104167	hsa-miR-4646-5p	CLIP-seq
MIRT1104168	hsa-miR-4724-5p	CLIP-seq
MIRT1104169	hsa-miR-4740-5p	CLIP-seq
MIRT1104170	hsa-miR-661	CLIP-seq
MIRT1920582	hsa-miR-34c-3p	CLIP-seq
MIRT1920583	hsa-miR-4452	CLIP-seq
MIRT1920584	hsa-miR-4778-5p	CLIP-seq
MIRT1920582	hsa-miR-34c-3p	CLIP-seq
MIRT1920583	hsa-miR-4452	CLIP-seq
MIRT1920584	hsa-miR-4778-5p	CLIP-seq
MIRT2028481	hsa-miR-1204	CLIP-seq
MIRT2028482	hsa-miR-1972	CLIP-seq
MIRT2028483	hsa-miR-3605-3p	CLIP-seq
MIRT2028484	hsa-miR-4257	CLIP-seq
MIRT2028485	hsa-miR-4419a	CLIP-seq
MIRT2028486	hsa-miR-4459	CLIP-seq
MIRT2028487	hsa-miR-4510	CLIP-seq
MIRT2028488	hsa-miR-4691-3p	CLIP-seq
MIRT2028489	hsa-miR-4722-5p	CLIP-seq
MIRT2028490	hsa-miR-4731-3p	CLIP-seq
MIRT2028491	hsa-miR-4757-5p	CLIP-seq
MIRT2028492	hsa-miR-4789-5p	CLIP-seq
MIRT2028493	hsa-miR-4801	CLIP-seq
MIRT2028494	hsa-miR-765	CLIP-seq
MIRT2028494	hsa-miR-765	CLIP-seq

Show/Hide all(62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002357	Process	Defense response to tumor cell	IDA	19787053
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	ISS	8661146
GO:0005515	Function	Protein binding	IPI	17116753, 21224396, 25416956, 32296183
GO:0005764	Component	Lysosome	IDA	8661146, 22096579, 28464033
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	17116753
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	8661146
GO:0006622	Process	Protein targeting to lysosome	IEA
GO:0006622	Process	Protein targeting to lysosome	ISS	8661146
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS	8661146
GO:0012502	Process	Induction of programmed cell death	IDA	19787053
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0030133	Component	Transport vesicle	IDA	19787053
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS	8661146
GO:0031410	Component	Cytoplasmic vesicle	IDA	22009753
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	17116753, 22009753
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS	8661146
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	ISS	8661146
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS	8661146
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032991	Component	Protein-containing complex	IDA	17116753
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS	8661146
GO:0046007	Process	Negative regulation of activated T cell proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	28464033
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	ISS	8661146
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050868	Process	Negative regulation of T cell activation	ISS	8661146
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0050869	Process	Negative regulation of B cell activation	ISS	8661146
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS	8661146
GO:0061462	Process	Protein localization to lysosome	IEA
GO:0090160	Process	Golgi to lysosome transport	IEA
GO:0090160	Process	Golgi to lysosome transport	ISS	8661146
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	28464033
GO:0097214	Process	Positive regulation of lysosomal membrane permeability	IDA	19787053
GO:0140311	Function	Protein sequestering activity	IEA
GO:0140311	Function	Protein sequestering activity	ISS	8661146
GO:0140646	Process	Negative regulation of pre-B cell receptor expression	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS	8661146
GO:1903052	Process	Positive regulation of proteolysis involved in protein catabolic process	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	ISS	8661146
GO:1904093	Process	Negative regulation of autophagic cell death	IDA	19787053
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	ISS	8661146
GO:2000646	Process	Positive regulation of receptor catabolic process	IEA
GO:2000646	Process	Positive regulation of receptor catabolic process	ISS	8661146

MIM	HGNC	e!Ensembl
601476	29612	ENSG00000162511

Protein

UniProt ID

Q13571

Protein name

Lysosomal-associated transmembrane protein 5 (Lysosomal-associated multitransmembrane protein 5) (Retinoic acid-inducible E3 protein)

Protein function

May have a special functional role during embryogenesis and in adult hematopoietic cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03821	Mtp	28 → 261	Golgi 4-transmembrane spanning transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney. {ECO:0000269|PubMed

Sequence

MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI
ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY
LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP
HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE
EALSLPSKTPEGGPAPPPYSEV

Sequence length

262

Interactions

View interactions

	KEGG
	Lysosome

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hepatocellular Carcinoma	Hepatocellular carcinoma	Genome-Scale CRISPR screen identifies LAPTM5 driving lenvatinib resistance in hepatocellular carcinoma	36037300	CBGDA

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35091468
Atherosclerosis	Associate	34925641
Atrial Fibrillation	Associate	35919038, 36226239
Breast Neoplasms	Associate	35294039, 36799186
Carcinogenesis	Associate	27058622
Carcinoma Hepatocellular	Associate	36037300
Carcinoma Non Small Cell Lung	Inhibit	27058622
Carcinoma Non Small Cell Lung	Associate	40280227
Carcinoma Squamous Cell	Associate	33428598
Diabetic Nephropathies	Associate	36154667
Esophageal Squamous Cell Carcinoma	Inhibit	27058622
Fibrosis	Associate	33922101
Glomerulonephritis Membranous	Associate	19787053
Hypertension	Associate	35157609
Hypertrophy Left Ventricular	Stimulate	35157609
Kidney Neoplasms	Associate	35842443
Leukemia	Associate	25928846
Lymphoma Non Hodgkin	Associate	36945359
Lysosomal Storage Diseases	Associate	19787053
Multiple Sclerosis	Associate	16504146
Muscular Dystrophy Duchenne	Associate	34922439
Nasal Polyps	Associate	36466903
Neoplasm Metastasis	Inhibit	35294039
Neoplasm Metastasis	Associate	35842443
Neoplasms	Associate	26903547, 35842443
Neoplasms	Inhibit	27058622, 35294039
Neoplasms	Stimulate	36799186
Neuroblastoma	Associate	19787053, 22009753
Neuroblastoma	Inhibit	27058622
Spinal Dysraphism	Associate	35294039
Squamous Intraepithelial Lesions	Associate	37410084
Synovitis	Associate	35711523
Synovitis Pigmented Villonodular	Associate	16508983
Uterine Cervical Neoplasms	Associate	37410084
Vascular Calcification	Associate	34922439
Waldenstrom Macroglobulinemia	Associate	26903547

LAPTM5 (lysosomal protein transmembrane 5)