Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	780
Gene name	Discoidin domain receptor tyrosine kinase 1
Gene symbol	DDR1
Synonyms (NCBI Gene)	CAKCD167DDREDDR1HGK2MCK10NEPNTRK4PTK3PTK3ARTK6TRKE
Chromosome	6
Chromosome location	6p21.33
Summary	Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of ty

258

Show/Hide all (258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT006812	hsa-miR-199b-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	22374871
MIRT006812	hsa-miR-199b-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	22374871
MIRT017205	hsa-miR-335-5p	Microarray	18185580
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	26655502
MIRT929456	hsa-miR-125a-3p	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929458	hsa-miR-1908	CLIP-seq
MIRT929459	hsa-miR-3134	CLIP-seq
MIRT929460	hsa-miR-361-3p	CLIP-seq
MIRT929461	hsa-miR-3934	CLIP-seq
MIRT929462	hsa-miR-4489	CLIP-seq
MIRT929463	hsa-miR-4508	CLIP-seq
MIRT929464	hsa-miR-4534	CLIP-seq
MIRT929465	hsa-miR-4640-3p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929467	hsa-miR-4802-5p	CLIP-seq
MIRT929468	hsa-miR-663	CLIP-seq
MIRT929469	hsa-miR-744	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT929471	hsa-miR-765	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT929473	hsa-miR-1224-5p	CLIP-seq
MIRT929474	hsa-miR-1237	CLIP-seq
MIRT929475	hsa-miR-1238	CLIP-seq
MIRT929476	hsa-miR-1248	CLIP-seq
MIRT929477	hsa-miR-1252	CLIP-seq
MIRT929456	hsa-miR-125a-3p	CLIP-seq
MIRT929478	hsa-miR-1273	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929480	hsa-miR-130a	CLIP-seq
MIRT929481	hsa-miR-130b	CLIP-seq
MIRT929482	hsa-miR-134	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929483	hsa-miR-185	CLIP-seq
MIRT929458	hsa-miR-1908	CLIP-seq
MIRT929484	hsa-miR-1909	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT929486	hsa-miR-2355-3p	CLIP-seq
MIRT929487	hsa-miR-2467-3p	CLIP-seq
MIRT929488	hsa-miR-301a	CLIP-seq
MIRT929489	hsa-miR-301b	CLIP-seq
MIRT929490	hsa-miR-3118	CLIP-seq
MIRT929459	hsa-miR-3134	CLIP-seq
MIRT929491	hsa-miR-3135	CLIP-seq
MIRT929492	hsa-miR-3136-5p	CLIP-seq
MIRT929493	hsa-miR-3152-5p	CLIP-seq
MIRT929494	hsa-miR-3179	CLIP-seq
MIRT929495	hsa-miR-3180	CLIP-seq
MIRT929496	hsa-miR-3180-3p	CLIP-seq
MIRT929497	hsa-miR-3183	CLIP-seq
MIRT929498	hsa-miR-3185	CLIP-seq
MIRT929499	hsa-miR-3196	CLIP-seq
MIRT929500	hsa-miR-3202	CLIP-seq
MIRT929501	hsa-miR-337-3p	CLIP-seq
MIRT929502	hsa-miR-3591-5p	CLIP-seq
MIRT929460	hsa-miR-361-3p	CLIP-seq
MIRT929503	hsa-miR-3616-3p	CLIP-seq
MIRT929504	hsa-miR-3655	CLIP-seq
MIRT929505	hsa-miR-3657	CLIP-seq
MIRT929506	hsa-miR-3666	CLIP-seq
MIRT929507	hsa-miR-3909	CLIP-seq
MIRT929461	hsa-miR-3934	CLIP-seq
MIRT929508	hsa-miR-4261	CLIP-seq
MIRT929509	hsa-miR-4269	CLIP-seq
MIRT929510	hsa-miR-4271	CLIP-seq
MIRT929511	hsa-miR-4280	CLIP-seq
MIRT929512	hsa-miR-4282	CLIP-seq
MIRT929513	hsa-miR-4289	CLIP-seq
MIRT929514	hsa-miR-4295	CLIP-seq
MIRT929515	hsa-miR-4306	CLIP-seq
MIRT929516	hsa-miR-4436b-3p	CLIP-seq
MIRT929517	hsa-miR-4439	CLIP-seq
MIRT929518	hsa-miR-4446-3p	CLIP-seq
MIRT929519	hsa-miR-4450	CLIP-seq
MIRT929520	hsa-miR-4457	CLIP-seq
MIRT929521	hsa-miR-4476	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT929462	hsa-miR-4489	CLIP-seq
MIRT929523	hsa-miR-4492	CLIP-seq
MIRT929524	hsa-miR-4496	CLIP-seq
MIRT929525	hsa-miR-4498	CLIP-seq
MIRT929526	hsa-miR-4505	CLIP-seq
MIRT929463	hsa-miR-4508	CLIP-seq
MIRT929527	hsa-miR-4513	CLIP-seq
MIRT929528	hsa-miR-4533	CLIP-seq
MIRT929464	hsa-miR-4534	CLIP-seq
MIRT929529	hsa-miR-454	CLIP-seq
MIRT929465	hsa-miR-4640-3p	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929531	hsa-miR-4644	CLIP-seq
MIRT929532	hsa-miR-4649-5p	CLIP-seq
MIRT929533	hsa-miR-4661-3p	CLIP-seq
MIRT929534	hsa-miR-4669	CLIP-seq
MIRT929535	hsa-miR-4671-3p	CLIP-seq
MIRT929536	hsa-miR-4690-5p	CLIP-seq
MIRT929537	hsa-miR-4693-3p	CLIP-seq
MIRT929538	hsa-miR-4700-3p	CLIP-seq
MIRT929539	hsa-miR-4711-3p	CLIP-seq
MIRT929540	hsa-miR-4712-3p	CLIP-seq
MIRT929541	hsa-miR-4721	CLIP-seq
MIRT929542	hsa-miR-4723-3p	CLIP-seq
MIRT929543	hsa-miR-4725-3p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929546	hsa-miR-4747-5p	CLIP-seq
MIRT929547	hsa-miR-4751	CLIP-seq
MIRT929548	hsa-miR-4773	CLIP-seq
MIRT929549	hsa-miR-4795-3p	CLIP-seq
MIRT929550	hsa-miR-4796-5p	CLIP-seq
MIRT929467	hsa-miR-4802-5p	CLIP-seq
MIRT929551	hsa-miR-494	CLIP-seq
MIRT929552	hsa-miR-541	CLIP-seq
MIRT929553	hsa-miR-548c-3p	CLIP-seq
MIRT929554	hsa-miR-556-3p	CLIP-seq
MIRT929555	hsa-miR-574-5p	CLIP-seq
MIRT929556	hsa-miR-578	CLIP-seq
MIRT929557	hsa-miR-592	CLIP-seq
MIRT929558	hsa-miR-593	CLIP-seq
MIRT929559	hsa-miR-599	CLIP-seq
MIRT929560	hsa-miR-654-5p	CLIP-seq
MIRT929468	hsa-miR-663	CLIP-seq
MIRT929561	hsa-miR-665	CLIP-seq
MIRT929562	hsa-miR-676	CLIP-seq
MIRT929469	hsa-miR-744	CLIP-seq
MIRT929563	hsa-miR-762	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT929471	hsa-miR-765	CLIP-seq
MIRT929474	hsa-miR-1237	CLIP-seq
MIRT929476	hsa-miR-1248	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT929486	hsa-miR-2355-3p	CLIP-seq
MIRT929504	hsa-miR-3655	CLIP-seq
MIRT1975216	hsa-miR-3907	CLIP-seq
MIRT929507	hsa-miR-3909	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929556	hsa-miR-578	CLIP-seq
MIRT929562	hsa-miR-676	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT1975217	hsa-miR-3168	CLIP-seq
MIRT929502	hsa-miR-3591-5p	CLIP-seq
MIRT1975218	hsa-miR-4302	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT1975219	hsa-miR-4699-3p	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT2210591	hsa-miR-1287	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929480	hsa-miR-130a	CLIP-seq
MIRT929481	hsa-miR-130b	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT2210592	hsa-miR-2276	CLIP-seq
MIRT929488	hsa-miR-301a	CLIP-seq
MIRT929489	hsa-miR-301b	CLIP-seq
MIRT2210593	hsa-miR-3145-5p	CLIP-seq
MIRT2210594	hsa-miR-3154	CLIP-seq
MIRT2210595	hsa-miR-3184	CLIP-seq
MIRT929506	hsa-miR-3666	CLIP-seq
MIRT2210596	hsa-miR-423-5p	CLIP-seq
MIRT929514	hsa-miR-4295	CLIP-seq
MIRT2210597	hsa-miR-4434	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT2210598	hsa-miR-4516	CLIP-seq
MIRT929529	hsa-miR-454	CLIP-seq
MIRT929535	hsa-miR-4671-3p	CLIP-seq
MIRT2210599	hsa-miR-4688	CLIP-seq
MIRT1975219	hsa-miR-4699-3p	CLIP-seq
MIRT2210600	hsa-miR-4728-5p	CLIP-seq
MIRT2210601	hsa-miR-4764-5p	CLIP-seq
MIRT2210602	hsa-miR-486-3p	CLIP-seq
MIRT2210603	hsa-miR-508-5p	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929540	hsa-miR-4712-3p	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929482	hsa-miR-134	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929458	hsa-miR-1908	CLIP-seq
MIRT929490	hsa-miR-3118	CLIP-seq
MIRT929492	hsa-miR-3136-5p	CLIP-seq
MIRT929495	hsa-miR-3180	CLIP-seq
MIRT929496	hsa-miR-3180-3p	CLIP-seq
MIRT929499	hsa-miR-3196	CLIP-seq
MIRT929503	hsa-miR-3616-3p	CLIP-seq
MIRT929505	hsa-miR-3657	CLIP-seq
MIRT929517	hsa-miR-4439	CLIP-seq
MIRT929518	hsa-miR-4446-3p	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT929462	hsa-miR-4489	CLIP-seq
MIRT929523	hsa-miR-4492	CLIP-seq
MIRT929525	hsa-miR-4498	CLIP-seq
MIRT929526	hsa-miR-4505	CLIP-seq
MIRT929463	hsa-miR-4508	CLIP-seq
MIRT929527	hsa-miR-4513	CLIP-seq
MIRT929534	hsa-miR-4669	CLIP-seq
MIRT929541	hsa-miR-4721	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929468	hsa-miR-663	CLIP-seq
MIRT929469	hsa-miR-744	CLIP-seq
MIRT929563	hsa-miR-762	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929483	hsa-miR-185	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT2514546	hsa-miR-3151	CLIP-seq
MIRT2514547	hsa-miR-320e	CLIP-seq
MIRT1975216	hsa-miR-3907	CLIP-seq
MIRT2514548	hsa-miR-3925-3p	CLIP-seq
MIRT2514549	hsa-miR-4270	CLIP-seq
MIRT1975218	hsa-miR-4302	CLIP-seq
MIRT929515	hsa-miR-4306	CLIP-seq
MIRT2514550	hsa-miR-4441	CLIP-seq
MIRT2514551	hsa-miR-4488	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929531	hsa-miR-4644	CLIP-seq
MIRT2514552	hsa-miR-4691-3p	CLIP-seq
MIRT2514553	hsa-miR-4697-5p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929550	hsa-miR-4796-5p	CLIP-seq
MIRT2514554	hsa-miR-637	CLIP-seq
MIRT929561	hsa-miR-665	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT2514555	hsa-miR-766	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929483	hsa-miR-185	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT2514546	hsa-miR-3151	CLIP-seq
MIRT2514547	hsa-miR-320e	CLIP-seq
MIRT929501	hsa-miR-337-3p	CLIP-seq
MIRT1975216	hsa-miR-3907	CLIP-seq
MIRT2514548	hsa-miR-3925-3p	CLIP-seq
MIRT2514549	hsa-miR-4270	CLIP-seq
MIRT2679143	hsa-miR-4286	CLIP-seq
MIRT1975218	hsa-miR-4302	CLIP-seq
MIRT929515	hsa-miR-4306	CLIP-seq
MIRT2514550	hsa-miR-4441	CLIP-seq
MIRT2514551	hsa-miR-4488	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929531	hsa-miR-4644	CLIP-seq
MIRT2514552	hsa-miR-4691-3p	CLIP-seq
MIRT2514553	hsa-miR-4697-5p	CLIP-seq
MIRT2679144	hsa-miR-4713-5p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929550	hsa-miR-4796-5p	CLIP-seq
MIRT2514554	hsa-miR-637	CLIP-seq
MIRT929561	hsa-miR-665	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT2514555	hsa-miR-766	CLIP-seq

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	9659899
GO:0005515	Function	Protein binding	IPI	16337946, 18190796, 32296183, 33961781, 35384245
GO:0005518	Function	Collagen binding	IBA
GO:0005518	Function	Collagen binding	IDA	9659899
GO:0005518	Function	Collagen binding	IEA
GO:0005518	Function	Collagen binding	IMP	12065315
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8390675
GO:0007155	Process	Cell adhesion	TAS	8302582
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010715	Process	Regulation of extracellular matrix disassembly	IEA
GO:0010715	Process	Regulation of extracellular matrix disassembly	IMP	12065315
GO:0010976	Process	Positive regulation of neuron projection development	IBA
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014909	Process	Smooth muscle cell migration	IMP	12065315
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0038062	Function	Protein tyrosine kinase collagen receptor activity	IBA
GO:0038062	Function	Protein tyrosine kinase collagen receptor activity	IDA	9659899, 21044884
GO:0038062	Function	Protein tyrosine kinase collagen receptor activity	IEA
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IDA	9659899, 21044884
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IEA
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IMP	12065315
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	21044884
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043583	Process	Ear development	IEA
GO:0044319	Process	Wound healing, spreading of cells	IEA
GO:0044319	Process	Wound healing, spreading of cells	IMP	12065315
GO:0046777	Process	Protein autophosphorylation	IDA	9659899
GO:0046872	Function	Metal ion binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0061302	Process	Smooth muscle cell-matrix adhesion	IEA
GO:0061302	Process	Smooth muscle cell-matrix adhesion	IMP	12065315
GO:0061564	Process	Axon development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:1990138	Process	Neuron projection extension	IEA

MIM	HGNC	e!Ensembl
600408	2730	ENSG00000204580

Q08345

Protein name

Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protei

Protein function

Tyrosine kinase that functions as a cell surface receptor for fibrillar collagen and regulates cell attachment to the extracellular matrix, remodeling of the extracellular matrix, cell migration, differentiation, survival and cell proliferation.

PDB

3ZOS , 4AG4 , 4BKJ , 4CKR , 5BVK , 5BVN , 5BVO , 5BVW , 5FDP , 5FDX , 5SAU , 5SAV , 5SAW , 5SAX , 5SAY , 5SAZ , 5SB0 , 5SB1 , 5SB2 , 6BRJ , 6BSD , 6FEW , 6FEX , 6FIL , 6FIN , 6FIO , 6FIQ , 6GWR , 6HP9 , 6Y23 , 7BCM , 7BE6 , 7FEH , 8PE9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00754	F5_F8_type_C	46 → 182	F5/8 type C domain	Domain
PF07714	PK_Tyr_Ser-Thr	610 → 905	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in T-47D, MDA-MB-175 and HBL-100 breast carcinoma cells, A-431 epidermoid carcinoma cells, SW48 and SNU-C2B colon carcinoma cells and Hs 294T melanoma cells (at protein level). Expressed at low levels in most adult tissues and

Sequence

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV

Sequence length

913

Interactions

View interactions

	Reactome
			Non-integrin membrane-ECM interactions

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Adrenocortical carcinoma, hereditary	Benign	rs147091812	RCV005913057
Cervical cancer	Benign	rs147091812	RCV005913058
Cholangiocarcinoma	Benign	rs147091812	RCV005913069
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	rs147091812	RCV005913072
Clear cell carcinoma of kidney	Benign	rs147091812	RCV005913059
Colorectal cancer	Benign	rs147091812	RCV005913061
Familial cancer of breast	Benign	rs147091812	RCV005913054
Familial pancreatic carcinoma	Benign	rs147091812	RCV005913060
Gastric cancer	Benign	rs147091812	RCV005913063
Lung cancer	Benign	rs147091812	RCV005913070
Lymphoma	Benign	rs147091812	RCV005913064
Malignant tumor of esophagus	Benign	rs147091812	RCV005913055
Malignant tumor of urinary bladder	Likely benign	rs55901302	RCV005907660
Melanoma	Benign	rs147091812	RCV005913068
Nonpapillary renal cell carcinoma	Benign	rs147091812	RCV005913056
Ovarian serous cystadenocarcinoma	Benign; Likely benign	rs147091812, rs55901302	RCV005913065 RCV005907661
Sarcoma	Benign	rs147091812	RCV005913062
Thymoma	Benign; Likely benign	rs147091812, rs55901302	RCV005913066 RCV005907662
Thyroid cancer, nonmedullary, 1	Benign	rs147091812	RCV005913067
Uterine corpus endometrial carcinoma	Benign	rs147091812	RCV005913071

Show/Hide Text Mining Associations (89)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achalasia Addisonianism Alacrimia syndrome	Associate	25155634
Adenoma	Associate	37271822
Alzheimer Disease	Associate	37194065
Ameloblastoma	Stimulate	24723326
Aneuploidy	Associate	40401507
Atherosclerosis	Associate	15111304, 18065762, 24768818
Azoospermia Nonobstructive	Associate	25064398
Bipolar Disorder	Associate	38395959
Brain Neoplasms	Associate	37147958
Breast Neoplasms	Associate	16440311, 25155634, 25667101, 25774665, 26655502, 28591735, 32668815, 36484686
Bronchiectasis	Stimulate	40536885
Burkitt Lymphoma	Associate	24136166
Carcinogenesis	Associate	21398698, 26286316, 31253192, 32716315, 37117273
Carcinoma Ductal Breast	Associate	25824769
Carcinoma Hepatocellular	Associate	20799954, 29559654, 32090682, 32716315, 34335575, 34664394, 34815375, 35140331, 37117273, 39284684
Carcinoma Intraductal Noninfiltrating	Associate	25667101
Carcinoma Non Small Cell Lung	Associate	18083107
Carcinoma Ovarian Epithelial	Associate	28887161
Carcinoma Pancreatic Ductal	Stimulate	26297342
Carcinoma Pancreatic Ductal	Associate	33213062, 34688654
Carcinoma Renal Cell	Associate	27020590, 27220961, 31018949
Chromosomal Instability	Associate	40401507
Churg Strauss Syndrome	Associate	16968898
Colonic Neoplasms	Associate	32090682
Colorectal Neoplasms	Associate	23899692, 35593476, 35969377, 37271822
COVID 19	Associate	34071309
Diabetes Mellitus	Associate	37446387
Diabetes Mellitus Type 1	Associate	19591919
Diabetic Nephropathies	Associate	31537649
Fatigue Syndrome Chronic	Associate	34403736
Fibrosis	Associate	11839585, 18065762, 21356365, 24768818, 37194065
Glioblastoma	Associate	31117874
Glioma	Associate	37147958, 38177123
HAIR AN syndrome	Associate	28591735
Hereditary leiomyomatosis and renal cell cancer	Associate	24136166
Hodgkin Disease	Associate	24136166
Hypoxia	Stimulate	26286316
Idiopathic Interstitial Pneumonias	Associate	28821283
Idiopathic Noncirrhotic Portal Hypertension	Associate	21356365
Idiopathic Pulmonary Fibrosis	Associate	15879152, 16507902
Inflammation	Associate	34071309, 37194065, 39284684, 39713856
Kidney Neoplasms	Associate	27020590
Leukemia	Associate	21398698, 24519883
Leukemia Myeloid	Associate	24519883
Leukemia Myeloid Acute	Associate	18270328, 22374871, 24519883
Lipoma	Associate	37768856
Lipomatosis Multiple Symmetrical	Associate	37768856
Liposarcoma	Associate	37768856
Liver Cirrhosis	Stimulate	11839585
Liver Cirrhosis	Associate	15136580, 21356365
Liver Cirrhosis Biliary	Associate	21356365
Liver Failure	Associate	39284684
Lung Diseases	Associate	16507902
Lung Neoplasms	Associate	21398698, 22522909, 23374247, 24768818, 27384677
Lymphangioleiomyomatosis	Stimulate	15111304
Lymphatic Metastasis	Associate	27020590
Lymphoma	Associate	24136166
Lymphoma Large B Cell Diffuse	Associate	40401507
Macular Degeneration	Associate	23455636
Mental Disorders	Associate	38395959
Mesothelioma	Associate	27384677
Microvascular Angina	Associate	34815375
Mouth Neoplasms	Associate	31253192
Multiple Myeloma	Associate	27718532
Myopathies Structural Congenital	Associate	30181556
Neoplasm Metastasis	Associate	21283680, 28591735, 34815375, 34830178, 35140331, 35935941, 37271822, 37768856
Neoplasms	Associate	16440311, 18065762, 20799954, 21398698, 21541037, 22522909, 23991074, 24723326, 24768818, 25422375, 26655502, 27020590, 27384677, 27605668, 28743276 View all (17 more)
Neoplasms	Stimulate	26286316, 28591735, 34815375
Neoplasms Vascular Tissue	Associate	15111304
Neoplastic Cells Circulating	Associate	34664394
Ovarian Neoplasms	Stimulate	21541037
Ovarian Neoplasms	Associate	28743276, 34837026
Pancreatic Neoplasms	Associate	27605668, 28368050, 33213062
Pancreatic Neoplasms	Stimulate	39713856
Peritoneal Neoplasms	Associate	29866925
Peritonitis	Associate	29866925
Pituitary Neoplasms	Associate	26286316
Prostatic Neoplasms	Associate	23661456, 32492656
Rhabdomyosarcoma	Associate	35957513
Root Resorption	Associate	39596178
Schizophrenia	Associate	38395959
Solitary Fibrous Tumors	Associate	20527023
Squamous Cell Carcinoma of Head and Neck	Associate	31253192
Stomach Neoplasms	Associate	29866925, 35935941
Systemic Inflammatory Response Syndrome	Associate	37271822
Tertiary Lymphoid Structures	Stimulate	37271822
Triple Negative Breast Neoplasms	Associate	25155634, 25667101
Urinary Bladder Neoplasms	Associate	33234027
Vitiligo	Associate	20182441

DDR1 (discoidin domain receptor tyrosine kinase 1)