Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7782
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 30 member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC30A4
Synonyms (NCBI Gene) Gene synonyms aliases
ZNT4, znT-4
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q21.1|15q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
Zinc is the second most abundant trace metal in the human body. It is an essential element, serving both a structural role, as in the formation of zinc fingers in DNA-binding proteins, and a catalytic role in metalloenzymes, such as pancreatic carboxypept
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021423 hsa-miR-9-5p Microarray 17612493
MIRT521043 hsa-miR-3120-3p HITS-CLIP 21572407
MIRT521042 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT521040 hsa-miR-190a-3p HITS-CLIP 21572407
MIRT521035 hsa-miR-1277-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005385 Function Zinc ion transmembrane transporter activity IBA 21873635
GO:0005515 Function Protein binding IPI 25657003, 26728129, 32296183
GO:0005737 Component Cytoplasm IDA 17349999
GO:0005765 Component Lysosomal membrane IEA
GO:0005770 Component Late endosome IDA 17349999
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602095 11015 ENSG00000104154
Protein
UniProt ID O14863
Protein name Probable proton-coupled zinc antiporter SLC30A4 (Solute carrier family 30 member 4) (Zinc transporter 4) (ZnT-4)
Protein function Probable proton-coupled zinc ion antiporter mediating zinc import from cytoplasm potentially into the endocytic compartment (PubMed:19521526). Controls zinc deposition in milk (By similarity). {ECO:0000250|UniProtKB:O35149, ECO:0000305|PubMed:19
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01545 Cation_efflux 114 332 Cation efflux family Family
Sequence
MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPER
PVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL
YLLFMIGELVGGYIANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLE
VLSAMISVLLVYILMGFLLYEAVQRTIHMNYEINGDIMLITAAVGVAVNVIMGFLLNQSG
HRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKPE
YKIADPICTYVFSLLVAFTTFRIIWDTVVIIL
EGVPSHLNVDYIKEALMKIEDVYSVEDL
NIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRT
CANCQSSSP
Sequence length 429
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
16580781
Associations from Text Mining
Disease Name Relationship Type References
Depressive Disorder Major Stimulate 27661418
Stomach Neoplasms Associate 33110097
Zinc Deficiency Neonatal due to Low Breast Milk Zinc Associate 25657003