Gene Gene information from NCBI Gene database.
Entrez ID 7782
Gene name Solute carrier family 30 member 4
Gene symbol SLC30A4
Synonyms (NCBI Gene)
ZNT4znT-4
Chromosome 15
Chromosome location 15q21.1|15q21.1
Summary Zinc is the second most abundant trace metal in the human body. It is an essential element, serving both a structural role, as in the formation of zinc fingers in DNA-binding proteins, and a catalytic role in metalloenzymes, such as pancreatic carboxypept
miRNA miRNA information provided by mirtarbase database.
334
miRTarBase ID miRNA Experiments Reference
MIRT021423 hsa-miR-9-5p Microarray 17612493
MIRT521043 hsa-miR-3120-3p HITS-CLIP 21572407
MIRT521042 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT521040 hsa-miR-190a-3p HITS-CLIP 21572407
MIRT521035 hsa-miR-1277-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0005385 Function Zinc ion transmembrane transporter activity IBA
GO:0005385 Function Zinc ion transmembrane transporter activity IDA 17349999, 19521526
GO:0005385 Function Zinc ion transmembrane transporter activity IEA
GO:0005515 Function Protein binding IPI 25657003, 26728129, 32296183, 36204728
GO:0005737 Component Cytoplasm IDA 17349999
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602095 11015 ENSG00000104154
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14863
Protein name Probable proton-coupled zinc antiporter SLC30A4 (Solute carrier family 30 member 4) (Zinc transporter 4) (ZnT-4)
Protein function Probable proton-coupled zinc ion antiporter mediating zinc import from cytoplasm potentially into the endocytic compartment (PubMed:19521526). Controls zinc deposition in milk (By similarity). {ECO:0000250|UniProtKB:O35149, ECO:0000305|PubMed:19
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01545 Cation_efflux 114 332 Cation efflux family Family
Sequence
MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPER
PVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL
YLLFMIGELVGGYIANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLE
VLSAMISVLLVYILMGFLLYEAVQRTIHMNYEINGDIMLITAAVGVAVNVIMGFLLNQSG
HRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKPE
YKIADPICTYVFSLLVAFTTFRIIWDTVVIIL
EGVPSHLNVDYIKEALMKIEDVYSVEDL
NIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRT
CANCQSSSP
Sequence length 429
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMERS DISEASE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Depressive Disorder Major Stimulate 27661418
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Associate 33110097
★☆☆☆☆
Found in Text Mining only
Zinc Deficiency Neonatal due to Low Breast Milk Zinc Associate 25657003
★☆☆☆☆
Found in Text Mining only