Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7763
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger AN1-type containing 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFAND5
Synonyms (NCBI Gene) Gene synonyms aliases
ZA20D2, ZFAND5A, ZNF216
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027817 hsa-miR-98-5p Microarray 19088304
MIRT031245 hsa-miR-19b-3p Sequencing 20371350
MIRT031311 hsa-miR-18a-5p Sequencing 20371350
MIRT051626 hsa-let-7e-5p CLASH 23622248
MIRT051626 hsa-let-7e-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0001944 Process Vasculature development IEA
GO:0003016 Process Respiratory system process IEA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16424905, 28514442, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604761 13008 ENSG00000107372
Protein
UniProt ID O76080
Protein name AN1-type zinc finger protein 5 (Zinc finger A20 domain-containing protein 2) (Zinc finger protein 216)
Protein function Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of N
PDB 7QXW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01754 zf-A20 12 35 A20-like zinc finger Family
PF01428 zf-AN1 154 191 AN1-like Zinc finger Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in skeletal muscle. Expressed in fetal cochlea. Also expressed in infant brain, fetal heart, pancreatic islet, melanocyte, pineal gland, placenta, corneal stroma, and parathyroid tumor. Weakly expressed or undetectable
Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT
SDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVS
EPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY
SDKHNCPYDYK
AEAAAKIRKENPVVVAEKIQRI
Sequence length 213
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diverticulitis Diverticulitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 37705049
Nasopharyngeal Carcinoma Associate 16308470