Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7709
Gene name	Zinc finger and BTB domain containing 17
Gene symbol	ZBTB17
Synonyms (NCBI Gene)	MIZ-1ZNF151ZNF60pHZ-67
Chromosome	1
Chromosome location	1p36.13
Summary	This gene encodes a zinc finger protein involved in the regulation of c-myc. The symbol MIZ1 has also been associated with PIAS2 which is a different gene located on chromosome 18. [provided by RefSeq, Jul 2008]

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439262	hsa-miR-544a	HITS-CLIP	24374217
MIRT439262	hsa-miR-544a	HITS-CLIP	24374217

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	9312026
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	19160485
GO:0001223	Function	Transcription coactivator binding	IPI	19160485
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9312026
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	9312026, 19160485
GO:0001702	Process	Gastrulation with mouth forming second	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12244100
GO:0005515	Function	Protein binding	IPI	9308237, 12244100, 14739298, 16352593, 18923429, 19164764, 26766587, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0007398	Process	Ectoderm development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19160485
GO:0032991	Component	Protein-containing complex	IDA	19160485
GO:0032993	Component	Protein-DNA complex	IMP	19160485
GO:0045786	Process	Negative regulation of cell cycle	TAS	12244100
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9312026
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19160485
GO:0046872	Function	Metal ion binding	IEA
GO:0070314	Process	G1 to G0 transition	IDA	19160485
GO:0140297	Function	DNA-binding transcription factor binding	IPI	19160485

MIM	HGNC	e!Ensembl
604084	12936	ENSG00000116809

Q13105

Protein name

Zinc finger and BTB domain-containing protein 17 (Myc-interacting zinc finger protein 1) (Miz-1) (Zinc finger protein 151) (Zinc finger protein 60)

Protein function

Transcription factor that can function as an activator or repressor depending on its binding partners, and by targeting negative regulators of cell cycle progression. Plays a critical role in early lymphocyte development, where it is essential t

PDB

2LVR , 2LVT , 2LVU , 2M0D , 2M0E , 2M0F , 2N25 , 2N26 , 2Q81 , 3M52 , 4U2M , 4U2N , 5ION , 7AZW , 7AZX , 7MC1 , 7MC2 , 7MC3 , 7T58

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	14 → 113	BTB/POZ domain	Domain
PF00096	zf-C2H2	306 → 328	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	390 → 412	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	418 → 440	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	446 → 468	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	474 → 496	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	530 → 552	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	558 → 580	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	586 → 608	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	614 → 637	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in germinal center B-cells. {ECO:0000269|PubMed:16142238}.

Sequence

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE

Sequence length

803

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Pathways in cancer Transcriptional misregulation in cancer Small cell lung cancer		XBP1(S) activates chaperone genes

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs12134932	RCV005919936
Cholangiocarcinoma	Benign	rs12134932	RCV005919942
Malignant lymphoma, large B-cell, diffuse	Benign	rs12134932	RCV005919939
Nonpapillary renal cell carcinoma	Benign	rs12134932	RCV005919937
Primary dilated cardiomyopathy	Uncertain significance	rs573935183	RCV001293158
Thymoma	Benign	rs12134932	RCV005919941
Uterine carcinosarcoma	Benign	rs12134932	RCV005919940
Uveal melanoma	Benign	rs12134932	RCV005919938
ZBTB17-related disorder	Benign; Likely benign	rs112062500, rs147654293, rs147516539, rs765796064, rs376259268, rs368013740, rs200322992, rs201683775	RCV003919870 RCV003904129 RCV003974204 RCV003914282 RCV003941810 RCV003934365 RCV003934626 RCV003964377

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Cardiomyopathy Dilated	Associate	21459883, 23570452, 28296976
Colonic Neoplasms	Associate	37370088
familial dilated cardiomyopathy	Associate	21459883
Oligodendroglioma	Associate	29890994
Stomach Neoplasms	Associate	31151932

ZBTB17 (zinc finger and BTB domain containing 17)