Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7709
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and BTB domain containing 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZBTB17
Synonyms (NCBI Gene) Gene synonyms aliases
MIZ-1, ZNF151, ZNF60, pHZ-67
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a zinc finger protein involved in the regulation of c-myc. The symbol MIZ1 has also been associated with PIAS2 which is a different gene located on chromosome 18. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439262 hsa-miR-544a HITS-CLIP 24374217
MIRT439262 hsa-miR-544a HITS-CLIP 24374217
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IMP 9312026
GO:0001046 Function Core promoter sequence-specific DNA binding IDA 19160485
GO:0001223 Function Transcription coactivator binding IPI 19160485
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604084 12936 ENSG00000116809
Protein
UniProt ID Q13105
Protein name Zinc finger and BTB domain-containing protein 17 (Myc-interacting zinc finger protein 1) (Miz-1) (Zinc finger protein 151) (Zinc finger protein 60)
Protein function Transcription factor that can function as an activator or repressor depending on its binding partners, and by targeting negative regulators of cell cycle progression. Plays a critical role in early lymphocyte development, where it is essential t
PDB 2LVR , 2LVT , 2LVU , 2M0D , 2M0E , 2M0F , 2N25 , 2N26 , 2Q81 , 3M52 , 4U2M , 4U2N , 5ION , 7AZW , 7AZX , 7MC1 , 7MC2 , 7MC3 , 7T58
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 14 113 BTB/POZ domain Domain
PF00096 zf-C2H2 306 328 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 390 412 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 418 440 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 446 468 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 474 496 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 530 552 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 558 580 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 586 608 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 614 637 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in germinal center B-cells. {ECO:0000269|PubMed:16142238}.
Sequence
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKS
LAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETH
DTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIH
SGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQH
TGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIH
TGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE
Sequence length 803
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer
  XBP1(S) activates chaperone genes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cardiomyopathy Dilated Associate 21459883, 23570452, 28296976
Colonic Neoplasms Associate 37370088
familial dilated cardiomyopathy Associate 21459883
Oligodendroglioma Associate 29890994
Stomach Neoplasms Associate 31151932