Gene Gene information from NCBI Gene database.
Entrez ID 7706
Gene name Tripartite motif containing 25
Gene symbol TRIM25
Synonyms (NCBI Gene)
EFPRNF147Z147ZNF147
Chromosome 17
Chromosome location 17q22
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presen
miRNA miRNA information provided by mirtarbase database.
1114
miRTarBase ID miRNA Experiments Reference
MIRT022249 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT037080 hsa-miR-877-3p CLASH 23622248
MIRT647865 hsa-miR-521 HITS-CLIP 23824327
MIRT647864 hsa-miR-7977 HITS-CLIP 23824327
MIRT495838 hsa-miR-4793-5p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
54
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0002753 Process Cytoplasmic pattern recognition receptor signaling pathway IDA 16125763, 20451243, 22607805
GO:0002753 Process Cytoplasmic pattern recognition receptor signaling pathway IDA 17392790
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0003723 Function RNA binding HDA 22658674
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600453 12932 ENSG00000121060
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14258
Protein name E3 ubiquitin/ISG15 ligase TRIM25 (EC 6.3.2.n3) (Estrogen-responsive finger protein) (RING finger protein 147) (RING-type E3 ubiquitin transferase) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM25) (Tripartite motif-containing protein 25) (Ubiquiti
Protein function Functions as a ubiquitin E3 ligase and as an ISG15 E3 ligase (PubMed:16352599). Involved in innate immune defense against viruses by mediating ubiquitination of RIGI and IFIH1 (PubMed:17392790, PubMed:29357390, PubMed:30193849, PubMed:31710640,
PDB 4CFG , 4LTB , 5EYA , 5FER , 5NT1 , 5NT2 , 6FLM , 6FLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 13 53 Domain
PF13765 PRY 459 507 SPRY-associated domain Family
PF00622 SPRY 511 629 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in breast tumors (at protein level). Ubiquitous. {ECO:0000269|PubMed:15130519, ECO:0000269|PubMed:22452784}.
Sequence
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCY
KKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSP
K
Sequence length 630
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NF-kappa B signaling pathway
RIG-I-like receptor signaling pathway
Influenza A
  ISG15 antiviral mechanism
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Termination of translesion DNA synthesis
Ovarian tumor domain proteases
Interferon gamma signaling
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
Negative regulators of DDX58/IFIH1 signaling