Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7706
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 25
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM25
Synonyms (NCBI Gene) Gene synonyms aliases
EFP, RNF147, Z147, ZNF147
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presen
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022249 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT037080 hsa-miR-877-3p CLASH 23622248
MIRT647865 hsa-miR-521 HITS-CLIP 23824327
MIRT647864 hsa-miR-7977 HITS-CLIP 23824327
MIRT495838 hsa-miR-4793-5p PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 19454348, 20818395, 22452784, 24478431, 32295922
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600453 12932 ENSG00000121060
Protein
UniProt ID Q14258
Protein name E3 ubiquitin/ISG15 ligase TRIM25 (EC 6.3.2.n3) (Estrogen-responsive finger protein) (RING finger protein 147) (RING-type E3 ubiquitin transferase) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM25) (Tripartite motif-containing protein 25) (Ubiquiti
Protein function Functions as a ubiquitin E3 ligase and as an ISG15 E3 ligase (PubMed:16352599). Involved in innate immune defense against viruses by mediating ubiquitination of RIGI and IFIH1 (PubMed:17392790, PubMed:29357390, PubMed:30193849, PubMed:31710640,
PDB 4CFG , 4LTB , 5EYA , 5FER , 5NT1 , 5NT2 , 6FLM , 6FLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 13 53 Domain
PF13765 PRY 459 507 SPRY-associated domain Family
PF00622 SPRY 511 629 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in breast tumors (at protein level). Ubiquitous. {ECO:0000269|PubMed:15130519, ECO:0000269|PubMed:22452784}.
Sequence
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCY
KKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSP
K
Sequence length 630
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
RIG-I-like receptor signaling pathway
Influenza A
  ISG15 antiviral mechanism
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Termination of translesion DNA synthesis
Ovarian tumor domain proteases
Interferon gamma signaling
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
Negative regulators of DDX58/IFIH1 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia, Hemolytic, Acquired rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Hemolytic uremic syndrome Hemolytic-Uremic Syndrome, Atypical Hemolytic Uremic Syndrome rs398124292, rs121964913, rs33972593, rs460897, rs121909590, rs121909583, rs460184, rs104886189, rs312262697, rs312262698, rs312262696, rs138924661, rs869312973, rs886039869, rs886039868
View all (24 more)
25854283
Kidney disease Chronic kidney disease stage 5 rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Nephrotic syndrome NEPHROTIC SYNDROME, TYPE 7 rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910
View all (152 more)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 10781795, 21542805
Carcinogenesis Associate 36635499, 38303029
Carcinoma Hepatocellular Inhibit 28861931
Carcinoma Hepatocellular Associate 32132870, 33858324
Carcinoma Non Small Cell Lung Associate 33931764, 34416231
Colonic Neoplasms Associate 31842382, 36611995
Colorectal Neoplasms Associate 28620119, 33966039, 36611995
COVID 19 Associate 33989516, 34031419, 37982908
Glioblastoma Associate 37011206
Glioblastoma Stimulate 38303029