Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7592
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 41
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF41
Synonyms (NCBI Gene) Gene synonyms aliases	MRX89
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MRX89
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that contains KRAB-A and KRAB-B domains multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. An initial study suggested that this gene may be associated with X-linked cognitiv

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439204	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439204	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1524013	hsa-miR-25	CLIP-seq
MIRT1524014	hsa-miR-32	CLIP-seq
MIRT1524015	hsa-miR-363	CLIP-seq
MIRT1524016	hsa-miR-367	CLIP-seq
MIRT1524017	hsa-miR-4325	CLIP-seq
MIRT1524018	hsa-miR-548c-3p	CLIP-seq
MIRT1524019	hsa-miR-92a	CLIP-seq
MIRT1524020	hsa-miR-92b	CLIP-seq
MIRT1524021	hsa-miR-1224-5p	CLIP-seq
MIRT1524022	hsa-miR-153	CLIP-seq
MIRT1524023	hsa-miR-2964a-3p	CLIP-seq
MIRT1524024	hsa-miR-337-3p	CLIP-seq
MIRT1524025	hsa-miR-448	CLIP-seq
MIRT1524026	hsa-miR-4668-5p	CLIP-seq
MIRT1524027	hsa-miR-4751	CLIP-seq
MIRT1524028	hsa-miR-4789-5p	CLIP-seq
MIRT1524029	hsa-miR-586	CLIP-seq
MIRT1524030	hsa-miR-617	CLIP-seq
MIRT2158386	hsa-miR-145	CLIP-seq
MIRT2377850	hsa-miR-1252	CLIP-seq
MIRT2377851	hsa-miR-1269	CLIP-seq
MIRT2377852	hsa-miR-1269b	CLIP-seq
MIRT2377853	hsa-miR-1288	CLIP-seq
MIRT2158386	hsa-miR-145	CLIP-seq
MIRT2377854	hsa-miR-1825	CLIP-seq
MIRT2377855	hsa-miR-199a-5p	CLIP-seq
MIRT2377856	hsa-miR-199b-5p	CLIP-seq
MIRT2377857	hsa-miR-3124-3p	CLIP-seq
MIRT2377858	hsa-miR-3180-5p	CLIP-seq
MIRT2377859	hsa-miR-4515	CLIP-seq
MIRT2377860	hsa-miR-4740-5p	CLIP-seq
MIRT2377861	hsa-miR-511	CLIP-seq
MIRT2377858	hsa-miR-3180-5p	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
314995	13107	ENSG00000147124

Protein

UniProt ID

P51814

Protein name

Zinc finger protein 41

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	68 → 109	KRAB box	Family
PF00096	zf-C2H2	313 → 335	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	369 → 391	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	397 → 419	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	425 → 447	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	453 → 475	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	481 → 503	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	509 → 531	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	537 → 559	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	565 → 587	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	593 → 615	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	621 → 643	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	649 → 671	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	677 → 699	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	706 → 727	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	733 → 755	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	761 → 783	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	789 → 811	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:14628291}.

Sequence

MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRSSADHAALN
SIVSLQASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFK
LEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELW
QDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKH
TLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAP
THHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHP
SVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHT
GEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKP
YVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICT
ECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGK
AFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQ
KSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNL
ITHQKIHTREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQ
IIHTGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD

Sequence length

821

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Attention deficit hyperactivity disorder	Attention deficit hyperactivity disorder	rs786205019
Autism	Autistic behavior	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Mental retardation	Severe intellectual disability, Moderate intellectual disability, Mental Retardation, X-Linked, MENTAL RETARDATION, X-LINKED 89	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	23871722, 14628291
Macrocephaly	Macrocephaly	rs786204854, rs764333096, rs1557739557
Mental retardation, x-linked	Mental Retardation, X-Linked 1	rs1603009115, rs199422240, rs199422234, rs782600511, rs199422235, rs199422236, rs199422237, rs199422238, rs199422239, rs2147483647, rs137852561, rs104894952, rs137852350, rs137852351, rs137852352 View all (405 more)	23871722
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)
Seizure	Tonic - clonic seizures	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Cognition Disorders	Associate	14628291
Intellectual Disability	Associate	14628291, 23871722
Mental Disorders	Associate	14628291
Mental Retardation X Linked	Associate	14628291, 16385466

ZNF41 (zinc finger protein 41)