Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7570
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 22
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF22
Synonyms (NCBI Gene) Gene synonyms aliases
HKR-T1, KOX15, ZNF422, Zfp422
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q11.21
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT648393 hsa-miR-6832-3p HITS-CLIP 23824327
MIRT648394 hsa-miR-4469 HITS-CLIP 23824327
MIRT648392 hsa-miR-7113-3p HITS-CLIP 23824327
MIRT648391 hsa-miR-4287 HITS-CLIP 23824327
MIRT648390 hsa-miR-4685-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0003677 Function DNA binding ISS
GO:0005634 Component Nucleus ISS
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
194529 13012 ENSG00000165512
Protein
UniProt ID P17026
Protein name Zinc finger protein 22 (Zinc finger protein KOX15) (Zinc finger protein Krox-26)
Protein function Binds DNA through the consensus sequence 5'-CAATG-3'. May be involved in transcriptional regulation and may play a role in tooth formation (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 55 77 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 83 105 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 111 133 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 139 161 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 167 189 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: In the embryo, expressed in developing craniofacial structures including dental epithelium of maxillary molar tooth organs, tongue epithelium and muscle, and craniofacial bone osteoblasts. In the adult, expressed in mesoderm-derived ti
Sequence
MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTEC
EKSFSQSSTLFQHQKIH
TGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESF
KQSSNLIQHQRIH
TGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSS
HLRQHMKVH
KEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR
Sequence length 224
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Unknown
Disease term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Melanoma Associate 21606880
Neoplasms Associate 21606880
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 16029452