Gene Gene information from NCBI Gene database.
Entrez ID 7570
Gene name Zinc finger protein 22
Gene symbol ZNF22
Synonyms (NCBI Gene)
HKR-T1KOX15ZNF422Zfp422
Chromosome 10
Chromosome location 10q11.21
miRNA miRNA information provided by mirtarbase database.
243
miRTarBase ID miRNA Experiments Reference
MIRT648393 hsa-miR-6832-3p HITS-CLIP 23824327
MIRT648394 hsa-miR-4469 HITS-CLIP 23824327
MIRT648392 hsa-miR-7113-3p HITS-CLIP 23824327
MIRT648391 hsa-miR-4287 HITS-CLIP 23824327
MIRT648390 hsa-miR-4685-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding ISS
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005515 Function Protein binding IPI 35156780
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
194529 13012 ENSG00000165512
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17026
Protein name Zinc finger protein 22 (Zinc finger protein KOX15) (Zinc finger protein Krox-26)
Protein function Binds DNA through the consensus sequence 5'-CAATG-3'. May be involved in transcriptional regulation and may play a role in tooth formation (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 55 77 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 83 105 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 111 133 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 139 161 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 167 189 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: In the embryo, expressed in developing craniofacial structures including dental epithelium of maxillary molar tooth organs, tongue epithelium and muscle, and craniofacial bone osteoblasts. In the adult, expressed in mesoderm-derived ti
Sequence
MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTEC
EKSFSQSSTLFQHQKIH
TGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESF
KQSSNLIQHQRIH
TGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSS
HLRQHMKVH
KEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR
Sequence length 224
Interactions View interactions