Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7481
Gene name	Wnt family member 11
Gene symbol	WNT11
Synonyms (NCBI Gene)	HWNT11
Chromosome	11
Chromosome location	11q13.5
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT707431	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707430	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707429	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707428	hsa-miR-6083	HITS-CLIP	21572407
MIRT736461	hsa-miR-504-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCRFlow cytometry	33142356
MIRT707431	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707430	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707429	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707428	hsa-miR-6083	HITS-CLIP	21572407
MIRT1493556	hsa-miR-1291	CLIP-seq
MIRT1493557	hsa-miR-1915	CLIP-seq
MIRT1493558	hsa-miR-214	CLIP-seq
MIRT1493559	hsa-miR-24	CLIP-seq
MIRT1493560	hsa-miR-3155	CLIP-seq
MIRT1493561	hsa-miR-3155b	CLIP-seq
MIRT1493562	hsa-miR-328	CLIP-seq
MIRT1493563	hsa-miR-3619-5p	CLIP-seq
MIRT1493564	hsa-miR-3974	CLIP-seq
MIRT1493565	hsa-miR-4265	CLIP-seq
MIRT1493566	hsa-miR-4296	CLIP-seq
MIRT1493567	hsa-miR-4322	CLIP-seq
MIRT1493568	hsa-miR-4417	CLIP-seq
MIRT1493569	hsa-miR-4530	CLIP-seq
MIRT1493570	hsa-miR-4690-5p	CLIP-seq
MIRT1493571	hsa-miR-4742-3p	CLIP-seq
MIRT1493572	hsa-miR-4766-5p	CLIP-seq
MIRT1493573	hsa-miR-484	CLIP-seq
MIRT1493574	hsa-miR-488	CLIP-seq
MIRT1493575	hsa-miR-508-5p	CLIP-seq
MIRT1493576	hsa-miR-520a-5p	CLIP-seq
MIRT1493577	hsa-miR-525-5p	CLIP-seq
MIRT1493578	hsa-miR-761	CLIP-seq
MIRT1493558	hsa-miR-214	CLIP-seq
MIRT1493559	hsa-miR-24	CLIP-seq
MIRT1493560	hsa-miR-3155	CLIP-seq
MIRT1493561	hsa-miR-3155b	CLIP-seq
MIRT1493563	hsa-miR-3619-5p	CLIP-seq
MIRT1493569	hsa-miR-4530	CLIP-seq
MIRT1493570	hsa-miR-4690-5p	CLIP-seq
MIRT1493573	hsa-miR-484	CLIP-seq
MIRT1493578	hsa-miR-761	CLIP-seq
MIRT2397020	hsa-miR-1254	CLIP-seq
MIRT2397021	hsa-miR-3116	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ERG	Activation	21242973

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0003138	Process	Primary heart field specification	IEA
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003283	Process	Atrial septum development	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	NAS	24431302
GO:0005125	Function	Cytokine activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 30886144, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	20103596, 20219091
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IMP	20219091
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	NAS	24431302
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030282	Process	Bone mineralization	IEA
GO:0030295	Function	Protein kinase activator activity	IMP	20219091
GO:0030325	Process	Adrenal gland development	IEP	9757009
GO:0031012	Component	Extracellular matrix	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	20103596
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045199	Process	Maintenance of epithelial cell apical/basal polarity	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19847889
GO:0048341	Process	Paraxial mesoderm formation	IEA
GO:0048570	Process	Notochord morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IEP	9757009
GO:0048844	Process	Artery morphogenesis	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060197	Process	Cloacal septation	IEP	9757009
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060484	Process	Lung-associated mesenchyme development	IEP	9757009
GO:0060675	Process	Ureteric bud morphogenesis	IEP	9757009
GO:0061037	Process	Negative regulation of cartilage development	NAS	9757009
GO:0061053	Process	Somite development	IEA
GO:0061101	Process	Neuroendocrine cell differentiation	IMP	20219091
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070830	Process	Bicellular tight junction assembly	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072177	Process	Mesonephric duct development	IEP	9757009
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	20103596
GO:0090272	Process	Negative regulation of fibroblast growth factor production	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IEA
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
603699	12776	ENSG00000085741

O96014

Protein name

Protein Wnt-11

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	47 → 354	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal lung, kidney, adult heart, liver, skeletal muscle, and pancreas. {ECO:0000269|PubMed:11712081}.

Sequence

MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK

Sequence length

354

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking Ca2+ pathway PCP/CE pathway

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Bladder exstrophy-epispadias-cloacal extrophy complex	Uncertain significance; Benign	rs758816226, rs148302020	RCV000172903 RCV004556104
Hypospadias	Uncertain significance	rs2134559780	RCV001824104
WNT11-related disorder	Likely benign; Benign	rs375385565, rs148302020	RCV003911675 RCV003934766

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Bone Diseases Metabolic	Associate	34875064
Breast Neoplasms	Associate	32635983, 34493366, 34911552
Carcinogenesis	Associate	20103596, 27034261
Carcinoma Hepatocellular	Inhibit	20103596
Carcinoma Non Small Cell Lung	Associate	35692887
Carcinoma Pancreatic Ductal	Associate	31718047
Carcinoma Squamous Cell	Associate	23505429
Celiac Disease	Associate	35208504
Chylomicronemia Familial due to Circulating Inhibitor of Lipoprotein Lipase	Inhibit	29955137
Colorectal Neoplasms	Associate	24504536, 37587207
Cystitis Interstitial	Inhibit	29955137
Diastrophic dysplasia	Inhibit	16942611
Endometrial Neoplasms	Associate	23028188
Esophageal Squamous Cell Carcinoma	Associate	26261605
Femur bifid with monodactylous ectrodactyly	Associate	38275609
Fibrosis	Associate	29955137
Fractures Bone	Associate	34875064
Hand Foot Syndrome	Associate	38275609
Hepatitis C Chronic	Associate	36003399
Hypoxia	Associate	31834445
Lymphatic Metastasis	Stimulate	27034261
Lymphoma Large B Cell Diffuse	Associate	31804739
Mouth Neoplasms	Associate	21393552
Neoplasm Metastasis	Associate	20219091, 26261605, 37940644
Neoplasms	Inhibit	20103596, 23028188
Neoplasms	Stimulate	20219091
Neoplasms	Associate	20870744, 27034261, 29717114, 30255827, 31718047, 32635983, 34911552, 36003399
Osteoarthritis	Associate	29806631
Osteoporosis	Associate	34875064
Osteoporosis pseudoglioma syndrome	Associate	34875064
Ovarian Neoplasms	Associate	24606488
Papillomavirus Infections	Associate	27034261
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22426169, 33417298
Prostatic Neoplasms	Associate	20219091, 29717114
Squamous Cell Carcinoma of Head and Neck	Associate	21393552
Tinnitus	Associate	34482816
Uterine Cervical Neoplasms	Associate	27034261

WNT11 (Wnt family member 11)