Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7479
Gene name Gene Name - the full gene name approved by the HGNC.	Wnt family member 8B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WNT8B
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all(54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025654	hsa-miR-7-5p	Microarray	17612493
MIRT756277	hsa-miR-4757-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36814555
MIRT1493988	hsa-miR-103a	CLIP-seq
MIRT1493989	hsa-miR-107	CLIP-seq
MIRT1493990	hsa-miR-1179	CLIP-seq
MIRT1493991	hsa-miR-1225-3p	CLIP-seq
MIRT1493992	hsa-miR-1233	CLIP-seq
MIRT1493993	hsa-miR-1262	CLIP-seq
MIRT1493994	hsa-miR-1297	CLIP-seq
MIRT1493995	hsa-miR-1343	CLIP-seq
MIRT1493996	hsa-miR-1909	CLIP-seq
MIRT1493997	hsa-miR-2110	CLIP-seq
MIRT1493998	hsa-miR-214	CLIP-seq
MIRT1493999	hsa-miR-26a	CLIP-seq
MIRT1494000	hsa-miR-26b	CLIP-seq
MIRT1494001	hsa-miR-28-5p	CLIP-seq
MIRT1494002	hsa-miR-3139	CLIP-seq
MIRT1494003	hsa-miR-3619-5p	CLIP-seq
MIRT1494004	hsa-miR-3914	CLIP-seq
MIRT1494005	hsa-miR-3944-5p	CLIP-seq
MIRT1494006	hsa-miR-4271	CLIP-seq
MIRT1494007	hsa-miR-4422	CLIP-seq
MIRT1494008	hsa-miR-4433	CLIP-seq
MIRT1494009	hsa-miR-4465	CLIP-seq
MIRT1494010	hsa-miR-4519	CLIP-seq
MIRT1494011	hsa-miR-4667-5p	CLIP-seq
MIRT1494012	hsa-miR-4690-5p	CLIP-seq
MIRT1494013	hsa-miR-4700-5p	CLIP-seq
MIRT1494014	hsa-miR-4701-3p	CLIP-seq
MIRT1494015	hsa-miR-4725-3p	CLIP-seq
MIRT1494016	hsa-miR-4792	CLIP-seq
MIRT1494017	hsa-miR-508-5p	CLIP-seq
MIRT1494018	hsa-miR-520a-5p	CLIP-seq
MIRT1494019	hsa-miR-525-5p	CLIP-seq
MIRT1494020	hsa-miR-708	CLIP-seq
MIRT1494021	hsa-miR-761	CLIP-seq
MIRT1494022	hsa-miR-765	CLIP-seq
MIRT2397038	hsa-miR-4330	CLIP-seq
MIRT2397039	hsa-miR-4474-3p	CLIP-seq
MIRT2397040	hsa-miR-604	CLIP-seq
MIRT2397041	hsa-miR-644	CLIP-seq
MIRT2397042	hsa-miR-647	CLIP-seq
MIRT2662929	hsa-miR-1180	CLIP-seq
MIRT2662930	hsa-miR-3140-3p	CLIP-seq
MIRT2662931	hsa-miR-3617	CLIP-seq
MIRT2662932	hsa-miR-4497	CLIP-seq
MIRT2662933	hsa-miR-4664-3p	CLIP-seq
MIRT2662934	hsa-miR-641	CLIP-seq
MIRT2662929	hsa-miR-1180	CLIP-seq
MIRT2662930	hsa-miR-3140-3p	CLIP-seq
MIRT2662931	hsa-miR-3617	CLIP-seq
MIRT2662932	hsa-miR-4497	CLIP-seq
MIRT2662933	hsa-miR-4664-3p	CLIP-seq
MIRT2662934	hsa-miR-641	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9536085
GO:0007369	Process	Gastrulation	ISS	7635061
GO:0007399	Process	Nervous system development	TAS	9536085
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030182	Process	Neuron differentiation	ISS
GO:0032355	Process	Response to estradiol	NAS	11956596
GO:0032526	Process	Response to retinoic acid	NAS	11956596
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048263	Process	Determination of dorsal identity	ISS	7635061
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:1904886	Process	Beta-catenin destruction complex disassembly	TAS

MIM	HGNC	e!Ensembl
601396	12789	ENSG00000075290

Protein

UniProt ID

Q93098

Protein name

Protein Wnt-8b

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	34 → 334	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is restricted to the brain, and more specifically to the forebrain. {ECO:0000269|PubMed:9536085}.

Sequence

MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP

Sequence length

351

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking Disassembly of the destruction complex and recruitment of AXIN to the membrane

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	33197287
Carcinoma Hepatocellular	Associate	33197287
Endometrial Neoplasms	Associate	38211843
Nasopharyngeal Carcinoma	Associate	34287269
Neoplasm Metastasis	Associate	34287269
Polycystic Ovary Syndrome	Associate	29510649
Uterine Diseases	Associate	29510649

WNT8B (Wnt family member 8B)