Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7474
Gene name	Wnt family member 5A
Gene symbol	WNT5A
Synonyms (NCBI Gene)	hWNT5A
Chromosome	3
Chromosome location	3p14.3
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs78756487	AAAAAA>-,AA,AAA,AAAA,AAAAA,AAAAAAA,AAAAAAAA,AAAAAAAAA,AAAAAAAAAA,AAAAAAAAAAA	Uncertain-significance, conflicting-interpretations-of-pathogenicity	3 prime UTR variant
rs181894008	G>A,C,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs387906663	A>G	Pathogenic	Missense variant, coding sequence variant
rs587784562	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs786200925	C>G	Pathogenic	Missense variant, coding sequence variant
rs786204836	T>C	Pathogenic	Missense variant, coding sequence variant
rs869312850	C>G	Pathogenic	Missense variant, coding sequence variant
rs1553677967	->CCGCAG	Likely-pathogenic	Inframe insertion, coding sequence variant
rs1553677971	G>C	Likely-pathogenic	Missense variant, coding sequence variant

905

Show/Hide all (905)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005162	hsa-miR-30a-5p	pSILAC	18668040
MIRT020965	hsa-miR-155-5p	Proteomics	20584899
MIRT021154	hsa-miR-186-5p	Sequencing	20371350
MIRT005162	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT030983	hsa-miR-21-5p	Microarray	18591254
MIRT031969	hsa-miR-16-5p	Proteomics	18668040
MIRT049710	hsa-miR-92a-3p	CLASH	23622248
MIRT053729	hsa-miR-624-3p	Microarray	22942087
MIRT054742	hsa-miR-374a-5p	Luciferase reporter assayImmunofluorescence analysisqRT-PCR	24832599
MIRT054742	hsa-miR-374a-5p	Luciferase reporter assayImmunofluorescence analysisqRT-PCR	24832599
MIRT437852	hsa-miR-487b-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23426183
MIRT437852	hsa-miR-487b-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23426183
MIRT437852	hsa-miR-487b-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23426183
MIRT437852	hsa-miR-487b-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23426183
MIRT163508	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520161	hsa-miR-3924	HITS-CLIP	21572407
MIRT520160	hsa-miR-6083	HITS-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT163389	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520161	hsa-miR-3924	PAR-CLIP	23446348
MIRT520160	hsa-miR-6083	PAR-CLIP	23446348
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT439283	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439283	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT726096	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT726095	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assayqRT-PCRWestern blot	25475098
MIRT733715	hsa-miR-545-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33928018
MIRT733715	hsa-miR-545-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33928018
MIRT733717	hsa-miR-1270	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33928018
MIRT733717	hsa-miR-1270	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33928018
MIRT736847	hsa-miR-493-3p	Western blottingqRT-PCR	33793074
MIRT163508	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520161	hsa-miR-3924	HITS-CLIP	21572407
MIRT520160	hsa-miR-6083	HITS-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT163389	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520161	hsa-miR-3924	PAR-CLIP	23446348
MIRT520160	hsa-miR-6083	PAR-CLIP	23446348
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT756276	hsa-miR-4757-3p	Luciferase reporter assayWestern blottingqRT-PCR	36814555
MIRT1493815	hsa-miR-1293	CLIP-seq
MIRT1493816	hsa-miR-133a	CLIP-seq
MIRT1493817	hsa-miR-133b	CLIP-seq
MIRT1493818	hsa-miR-198	CLIP-seq
MIRT1493819	hsa-miR-219-2-3p	CLIP-seq
MIRT1493820	hsa-miR-2964a-3p	CLIP-seq
MIRT1493821	hsa-miR-3663-5p	CLIP-seq
MIRT1493822	hsa-miR-376a	CLIP-seq
MIRT1493823	hsa-miR-376b	CLIP-seq
MIRT1493824	hsa-miR-4422	CLIP-seq
MIRT1493825	hsa-miR-4483	CLIP-seq
MIRT1493826	hsa-miR-4508	CLIP-seq
MIRT1493827	hsa-miR-455-5p	CLIP-seq
MIRT1493828	hsa-miR-4656	CLIP-seq
MIRT1493829	hsa-miR-4696	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT1493832	hsa-miR-545	CLIP-seq
MIRT2148800	hsa-miR-3198	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2148802	hsa-miR-3679-3p	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2148804	hsa-miR-4309	CLIP-seq
MIRT2148805	hsa-miR-432	CLIP-seq
MIRT2148806	hsa-miR-4480	CLIP-seq
MIRT2148807	hsa-miR-4653-3p	CLIP-seq
MIRT2148808	hsa-miR-4662a-5p	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2369203	hsa-miR-1178	CLIP-seq
MIRT2369204	hsa-miR-1231	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2369206	hsa-miR-183	CLIP-seq
MIRT2369207	hsa-miR-4288	CLIP-seq
MIRT2369208	hsa-miR-4420	CLIP-seq
MIRT2369209	hsa-miR-452	CLIP-seq
MIRT2148808	hsa-miR-4662a-5p	CLIP-seq
MIRT2369210	hsa-miR-4676-3p	CLIP-seq
MIRT2369211	hsa-miR-4677-3p	CLIP-seq
MIRT2369212	hsa-miR-4679	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2369214	hsa-miR-4790-3p	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT2369215	hsa-miR-548q	CLIP-seq
MIRT2369216	hsa-miR-632	CLIP-seq
MIRT2369217	hsa-miR-885-5p	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2434717	hsa-miR-1184	CLIP-seq
MIRT2434718	hsa-miR-1205	CLIP-seq
MIRT2434719	hsa-miR-1237	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2434720	hsa-miR-1261	CLIP-seq
MIRT2434721	hsa-miR-1264	CLIP-seq
MIRT2434722	hsa-miR-1272	CLIP-seq
MIRT2434723	hsa-miR-1292	CLIP-seq
MIRT2434724	hsa-miR-1297	CLIP-seq
MIRT2434725	hsa-miR-1298	CLIP-seq
MIRT2434726	hsa-miR-1299	CLIP-seq
MIRT2434727	hsa-miR-1305	CLIP-seq
MIRT2434728	hsa-miR-132	CLIP-seq
MIRT2434729	hsa-miR-1322	CLIP-seq
MIRT2434730	hsa-miR-155	CLIP-seq
MIRT2434731	hsa-miR-15a	CLIP-seq
MIRT2434732	hsa-miR-15b	CLIP-seq
MIRT2434733	hsa-miR-16	CLIP-seq
MIRT2434734	hsa-miR-195	CLIP-seq
MIRT2434735	hsa-miR-2110	CLIP-seq
MIRT2434736	hsa-miR-212	CLIP-seq
MIRT2434737	hsa-miR-2355-3p	CLIP-seq
MIRT2434738	hsa-miR-26a	CLIP-seq
MIRT2434739	hsa-miR-26b	CLIP-seq
MIRT2434740	hsa-miR-298	CLIP-seq
MIRT2434741	hsa-miR-300	CLIP-seq
MIRT2434742	hsa-miR-3064-5p	CLIP-seq
MIRT2434743	hsa-miR-3074-3p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2434745	hsa-miR-3140-3p	CLIP-seq
MIRT2434746	hsa-miR-3152-3p	CLIP-seq
MIRT2434747	hsa-miR-3156-5p	CLIP-seq
MIRT2434748	hsa-miR-3158-5p	CLIP-seq
MIRT2434749	hsa-miR-3160-5p	CLIP-seq
MIRT2434750	hsa-miR-3163	CLIP-seq
MIRT2434751	hsa-miR-3173-5p	CLIP-seq
MIRT2434752	hsa-miR-3177-5p	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2434754	hsa-miR-338-5p	CLIP-seq
MIRT2434755	hsa-miR-340	CLIP-seq
MIRT2434756	hsa-miR-34b	CLIP-seq
MIRT2434757	hsa-miR-3607-3p	CLIP-seq
MIRT2434758	hsa-miR-3609	CLIP-seq
MIRT2434759	hsa-miR-3622b-5p	CLIP-seq
MIRT2434760	hsa-miR-3647-3p	CLIP-seq
MIRT2434761	hsa-miR-365	CLIP-seq
MIRT2434762	hsa-miR-3655	CLIP-seq
MIRT2434763	hsa-miR-3667-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2434765	hsa-miR-3675-3p	CLIP-seq
MIRT2148802	hsa-miR-3679-3p	CLIP-seq
MIRT2434766	hsa-miR-3681	CLIP-seq
MIRT2434767	hsa-miR-370	CLIP-seq
MIRT2434768	hsa-miR-371b-5p	CLIP-seq
MIRT2434769	hsa-miR-376c	CLIP-seq
MIRT2434770	hsa-miR-381	CLIP-seq
MIRT2434771	hsa-miR-3919	CLIP-seq
MIRT2434772	hsa-miR-3978	CLIP-seq
MIRT2434773	hsa-miR-424	CLIP-seq
MIRT2434774	hsa-miR-4263	CLIP-seq
MIRT2434775	hsa-miR-4268	CLIP-seq
MIRT2434776	hsa-miR-4269	CLIP-seq
MIRT2434777	hsa-miR-4271	CLIP-seq
MIRT2434778	hsa-miR-4290	CLIP-seq
MIRT2434779	hsa-miR-4305	CLIP-seq
MIRT2434780	hsa-miR-4310	CLIP-seq
MIRT2434781	hsa-miR-4328	CLIP-seq
MIRT2434782	hsa-miR-4434	CLIP-seq
MIRT2434783	hsa-miR-4448	CLIP-seq
MIRT2434784	hsa-miR-4465	CLIP-seq
MIRT2434785	hsa-miR-4471	CLIP-seq
MIRT2434786	hsa-miR-4477a	CLIP-seq
MIRT2434787	hsa-miR-4477b	CLIP-seq
MIRT2148806	hsa-miR-4480	CLIP-seq
MIRT2434788	hsa-miR-4481	CLIP-seq
MIRT2434789	hsa-miR-4514	CLIP-seq
MIRT2434790	hsa-miR-4516	CLIP-seq
MIRT2434791	hsa-miR-4524	CLIP-seq
MIRT2434792	hsa-miR-4646-5p	CLIP-seq
MIRT2148808	hsa-miR-4662a-5p	CLIP-seq
MIRT2434793	hsa-miR-4666-3p	CLIP-seq
MIRT2434794	hsa-miR-4666-5p	CLIP-seq
MIRT2434795	hsa-miR-4667-5p	CLIP-seq
MIRT2434796	hsa-miR-4692	CLIP-seq
MIRT2434797	hsa-miR-4698	CLIP-seq
MIRT2434798	hsa-miR-4700-5p	CLIP-seq
MIRT2434799	hsa-miR-4716-5p	CLIP-seq
MIRT2434800	hsa-miR-4724-3p	CLIP-seq
MIRT2434801	hsa-miR-4725-3p	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT2434802	hsa-miR-4742-5p	CLIP-seq
MIRT2434803	hsa-miR-4745-5p	CLIP-seq
MIRT2434804	hsa-miR-4747-5p	CLIP-seq
MIRT2434805	hsa-miR-4758-5p	CLIP-seq
MIRT2434806	hsa-miR-4760-3p	CLIP-seq
MIRT2434807	hsa-miR-4764-5p	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2434808	hsa-miR-4782-5p	CLIP-seq
MIRT2434809	hsa-miR-4796-5p	CLIP-seq
MIRT2434810	hsa-miR-4799-5p	CLIP-seq
MIRT2434811	hsa-miR-497	CLIP-seq
MIRT2434812	hsa-miR-503	CLIP-seq
MIRT2434813	hsa-miR-516b	CLIP-seq
MIRT2434814	hsa-miR-520g	CLIP-seq
MIRT2434815	hsa-miR-520h	CLIP-seq
MIRT2434816	hsa-miR-539	CLIP-seq
MIRT2434817	hsa-miR-544	CLIP-seq
MIRT1493832	hsa-miR-545	CLIP-seq
MIRT2434818	hsa-miR-548ag	CLIP-seq
MIRT2434819	hsa-miR-548ah	CLIP-seq
MIRT2434820	hsa-miR-548ai	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2434822	hsa-miR-548n	CLIP-seq
MIRT2434823	hsa-miR-548t	CLIP-seq
MIRT2434824	hsa-miR-556-3p	CLIP-seq
MIRT2434825	hsa-miR-576-3p	CLIP-seq
MIRT2434826	hsa-miR-576-5p	CLIP-seq
MIRT2434827	hsa-miR-587	CLIP-seq
MIRT2434828	hsa-miR-604	CLIP-seq
MIRT2434829	hsa-miR-606	CLIP-seq
MIRT2434830	hsa-miR-607	CLIP-seq
MIRT2434831	hsa-miR-616	CLIP-seq
MIRT2434832	hsa-miR-621	CLIP-seq
MIRT2434833	hsa-miR-629	CLIP-seq
MIRT2434834	hsa-miR-643	CLIP-seq
MIRT2434835	hsa-miR-646	CLIP-seq
MIRT2434836	hsa-miR-647	CLIP-seq
MIRT2434837	hsa-miR-660	CLIP-seq
MIRT2434838	hsa-miR-676	CLIP-seq
MIRT2434839	hsa-miR-767-5p	CLIP-seq
MIRT2369217	hsa-miR-885-5p	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2434840	hsa-miR-892b	CLIP-seq
MIRT2441685	hsa-miR-1266	CLIP-seq
MIRT2441686	hsa-miR-128	CLIP-seq
MIRT2441687	hsa-miR-199a-3p	CLIP-seq
MIRT2441688	hsa-miR-199b-3p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2441689	hsa-miR-3129-5p	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2441690	hsa-miR-3664-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2441691	hsa-miR-3941	CLIP-seq
MIRT2441692	hsa-miR-421	CLIP-seq
MIRT2441693	hsa-miR-4433	CLIP-seq
MIRT2441694	hsa-miR-4459	CLIP-seq
MIRT2441695	hsa-miR-4518	CLIP-seq
MIRT2441696	hsa-miR-466	CLIP-seq
MIRT2441697	hsa-miR-4672	CLIP-seq
MIRT2441698	hsa-miR-4709-5p	CLIP-seq
MIRT2441699	hsa-miR-4768-3p	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2441701	hsa-miR-577	CLIP-seq
MIRT2441702	hsa-miR-936	CLIP-seq
MIRT2434720	hsa-miR-1261	CLIP-seq
MIRT2463542	hsa-miR-22	CLIP-seq
MIRT2463543	hsa-miR-3130-5p	CLIP-seq
MIRT2463544	hsa-miR-3144-5p	CLIP-seq
MIRT2463545	hsa-miR-338-3p	CLIP-seq
MIRT2434766	hsa-miR-3681	CLIP-seq
MIRT2434782	hsa-miR-4434	CLIP-seq
MIRT2463546	hsa-miR-4435	CLIP-seq
MIRT2434788	hsa-miR-4481	CLIP-seq
MIRT2463547	hsa-miR-4482	CLIP-seq
MIRT2434790	hsa-miR-4516	CLIP-seq
MIRT2463548	hsa-miR-4633-3p	CLIP-seq
MIRT2434803	hsa-miR-4745-5p	CLIP-seq
MIRT2434805	hsa-miR-4758-5p	CLIP-seq
MIRT2463549	hsa-miR-499-3p	CLIP-seq
MIRT2463550	hsa-miR-499a-3p	CLIP-seq
MIRT2463551	hsa-miR-558	CLIP-seq
MIRT2434830	hsa-miR-607	CLIP-seq
MIRT2463552	hsa-miR-711	CLIP-seq
MIRT2463545	hsa-miR-338-3p	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2463546	hsa-miR-4435	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2463549	hsa-miR-499-3p	CLIP-seq
MIRT2463550	hsa-miR-499a-3p	CLIP-seq
MIRT2434830	hsa-miR-607	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2662774	hsa-miR-106a	CLIP-seq
MIRT2662775	hsa-miR-106b	CLIP-seq
MIRT2369203	hsa-miR-1178	CLIP-seq
MIRT2434717	hsa-miR-1184	CLIP-seq
MIRT2434718	hsa-miR-1205	CLIP-seq
MIRT2662776	hsa-miR-1208	CLIP-seq
MIRT2662777	hsa-miR-1236	CLIP-seq
MIRT2662778	hsa-miR-1243	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2434721	hsa-miR-1264	CLIP-seq
MIRT2441685	hsa-miR-1266	CLIP-seq
MIRT2662779	hsa-miR-1269	CLIP-seq
MIRT2662780	hsa-miR-1269b	CLIP-seq
MIRT2662781	hsa-miR-1271	CLIP-seq
MIRT2434722	hsa-miR-1272	CLIP-seq
MIRT2662782	hsa-miR-1273e	CLIP-seq
MIRT2662783	hsa-miR-1276	CLIP-seq
MIRT2662784	hsa-miR-1279	CLIP-seq
MIRT2441686	hsa-miR-128	CLIP-seq
MIRT2662785	hsa-miR-1288	CLIP-seq
MIRT2662786	hsa-miR-129-5p	CLIP-seq
MIRT2434724	hsa-miR-1297	CLIP-seq
MIRT2662787	hsa-miR-1321	CLIP-seq
MIRT2434729	hsa-miR-1322	CLIP-seq
MIRT2662788	hsa-miR-141	CLIP-seq
MIRT2662789	hsa-miR-146a	CLIP-seq
MIRT2662790	hsa-miR-146b-5p	CLIP-seq
MIRT2662791	hsa-miR-147	CLIP-seq
MIRT2662792	hsa-miR-1587	CLIP-seq
MIRT2434731	hsa-miR-15a	CLIP-seq
MIRT2434732	hsa-miR-15b	CLIP-seq
MIRT2434733	hsa-miR-16	CLIP-seq
MIRT2662793	hsa-miR-17	CLIP-seq
MIRT2662794	hsa-miR-182	CLIP-seq
MIRT2662795	hsa-miR-186	CLIP-seq
MIRT2662796	hsa-miR-188-5p	CLIP-seq
MIRT2662797	hsa-miR-1914	CLIP-seq
MIRT2434734	hsa-miR-195	CLIP-seq
MIRT2441687	hsa-miR-199a-3p	CLIP-seq
MIRT2441688	hsa-miR-199b-3p	CLIP-seq
MIRT2662798	hsa-miR-200a	CLIP-seq
MIRT2662799	hsa-miR-2052	CLIP-seq
MIRT2662800	hsa-miR-2053	CLIP-seq
MIRT2662801	hsa-miR-20a	CLIP-seq
MIRT2662802	hsa-miR-20b	CLIP-seq
MIRT2434735	hsa-miR-2110	CLIP-seq
MIRT2662803	hsa-miR-2113	CLIP-seq
MIRT2434737	hsa-miR-2355-3p	CLIP-seq
MIRT2434738	hsa-miR-26a	CLIP-seq
MIRT2434739	hsa-miR-26b	CLIP-seq
MIRT2434740	hsa-miR-298	CLIP-seq
MIRT2434741	hsa-miR-300	CLIP-seq
MIRT2434742	hsa-miR-3064-5p	CLIP-seq
MIRT2662804	hsa-miR-3117-5p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2662805	hsa-miR-3129-3p	CLIP-seq
MIRT2441689	hsa-miR-3129-5p	CLIP-seq
MIRT2662806	hsa-miR-3133	CLIP-seq
MIRT2662807	hsa-miR-3138	CLIP-seq
MIRT2434745	hsa-miR-3140-3p	CLIP-seq
MIRT2662808	hsa-miR-3148	CLIP-seq
MIRT2662809	hsa-miR-3149	CLIP-seq
MIRT2434747	hsa-miR-3156-5p	CLIP-seq
MIRT2434748	hsa-miR-3158-5p	CLIP-seq
MIRT2662810	hsa-miR-3159	CLIP-seq
MIRT2434749	hsa-miR-3160-5p	CLIP-seq
MIRT2662811	hsa-miR-3161	CLIP-seq
MIRT2434750	hsa-miR-3163	CLIP-seq
MIRT2434751	hsa-miR-3173-5p	CLIP-seq
MIRT2662812	hsa-miR-3190	CLIP-seq
MIRT2148800	hsa-miR-3198	CLIP-seq
MIRT2662813	hsa-miR-3200-3p	CLIP-seq
MIRT2662814	hsa-miR-3200-5p	CLIP-seq
MIRT2662815	hsa-miR-3202	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2662816	hsa-miR-33a	CLIP-seq
MIRT2662817	hsa-miR-33b	CLIP-seq
MIRT2434756	hsa-miR-34b	CLIP-seq
MIRT2434757	hsa-miR-3607-3p	CLIP-seq
MIRT2434758	hsa-miR-3609	CLIP-seq
MIRT2434759	hsa-miR-3622b-5p	CLIP-seq
MIRT2434760	hsa-miR-3647-3p	CLIP-seq
MIRT2434761	hsa-miR-365	CLIP-seq
MIRT2434762	hsa-miR-3655	CLIP-seq
MIRT2441690	hsa-miR-3664-3p	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2434763	hsa-miR-3667-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2434765	hsa-miR-3675-3p	CLIP-seq
MIRT2662818	hsa-miR-3677-5p	CLIP-seq
MIRT2662819	hsa-miR-3684	CLIP-seq
MIRT2662820	hsa-miR-369-3p	CLIP-seq
MIRT2434767	hsa-miR-370	CLIP-seq
MIRT2662821	hsa-miR-374a	CLIP-seq
MIRT2662822	hsa-miR-374b	CLIP-seq
MIRT2434770	hsa-miR-381	CLIP-seq
MIRT2662823	hsa-miR-3915	CLIP-seq
MIRT2434771	hsa-miR-3919	CLIP-seq
MIRT2662824	hsa-miR-3920	CLIP-seq
MIRT2662825	hsa-miR-3928	CLIP-seq
MIRT2441691	hsa-miR-3941	CLIP-seq
MIRT2662826	hsa-miR-3977	CLIP-seq
MIRT2434772	hsa-miR-3978	CLIP-seq
MIRT2662827	hsa-miR-409-3p	CLIP-seq
MIRT2441692	hsa-miR-421	CLIP-seq
MIRT2434773	hsa-miR-424	CLIP-seq
MIRT2662828	hsa-miR-4251	CLIP-seq
MIRT2434774	hsa-miR-4263	CLIP-seq
MIRT2662829	hsa-miR-4265	CLIP-seq
MIRT2434777	hsa-miR-4271	CLIP-seq
MIRT2662830	hsa-miR-4275	CLIP-seq
MIRT2434778	hsa-miR-4290	CLIP-seq
MIRT2662831	hsa-miR-4296	CLIP-seq
MIRT2662832	hsa-miR-4297	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2434779	hsa-miR-4305	CLIP-seq
MIRT2148804	hsa-miR-4309	CLIP-seq
MIRT2434780	hsa-miR-4310	CLIP-seq
MIRT2662833	hsa-miR-4311	CLIP-seq
MIRT2148805	hsa-miR-432	CLIP-seq
MIRT2662834	hsa-miR-4322	CLIP-seq
MIRT2662835	hsa-miR-4417	CLIP-seq
MIRT2369208	hsa-miR-4420	CLIP-seq
MIRT2441693	hsa-miR-4433	CLIP-seq
MIRT2662836	hsa-miR-4445	CLIP-seq
MIRT2662837	hsa-miR-4446-5p	CLIP-seq
MIRT2441694	hsa-miR-4459	CLIP-seq
MIRT2662838	hsa-miR-4464	CLIP-seq
MIRT2434784	hsa-miR-4465	CLIP-seq
MIRT2662839	hsa-miR-4470	CLIP-seq
MIRT2662840	hsa-miR-4473	CLIP-seq
MIRT2434786	hsa-miR-4477a	CLIP-seq
MIRT2662841	hsa-miR-4492	CLIP-seq
MIRT2662842	hsa-miR-4498	CLIP-seq
MIRT2662843	hsa-miR-450b-5p	CLIP-seq
MIRT2662844	hsa-miR-4515	CLIP-seq
MIRT2441695	hsa-miR-4518	CLIP-seq
MIRT2369209	hsa-miR-452	CLIP-seq
MIRT2434791	hsa-miR-4524	CLIP-seq
MIRT2662845	hsa-miR-4527	CLIP-seq
MIRT2662846	hsa-miR-4637	CLIP-seq
MIRT2662847	hsa-miR-4640-5p	CLIP-seq
MIRT2662848	hsa-miR-4642	CLIP-seq
MIRT2148807	hsa-miR-4653-3p	CLIP-seq
MIRT1493828	hsa-miR-4656	CLIP-seq
MIRT2441696	hsa-miR-466	CLIP-seq
MIRT2434793	hsa-miR-4666-3p	CLIP-seq
MIRT2434795	hsa-miR-4667-5p	CLIP-seq
MIRT2662849	hsa-miR-4671-3p	CLIP-seq
MIRT2441697	hsa-miR-4672	CLIP-seq
MIRT2662850	hsa-miR-4674	CLIP-seq
MIRT2662851	hsa-miR-4675	CLIP-seq
MIRT2369210	hsa-miR-4676-3p	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2434798	hsa-miR-4700-5p	CLIP-seq
MIRT2441698	hsa-miR-4709-5p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2434799	hsa-miR-4716-5p	CLIP-seq
MIRT2434800	hsa-miR-4724-3p	CLIP-seq
MIRT2434801	hsa-miR-4725-3p	CLIP-seq
MIRT2662852	hsa-miR-4726-5p	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT2662853	hsa-miR-4738-3p	CLIP-seq
MIRT2662854	hsa-miR-4739	CLIP-seq
MIRT2662855	hsa-miR-4740-5p	CLIP-seq
MIRT2662856	hsa-miR-4741	CLIP-seq
MIRT2434804	hsa-miR-4747-5p	CLIP-seq
MIRT2662857	hsa-miR-4748	CLIP-seq
MIRT2662858	hsa-miR-4752	CLIP-seq
MIRT2662859	hsa-miR-4756-5p	CLIP-seq
MIRT2434806	hsa-miR-4760-3p	CLIP-seq
MIRT2662860	hsa-miR-4766-3p	CLIP-seq
MIRT2441699	hsa-miR-4768-3p	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2662861	hsa-miR-4778-3p	CLIP-seq
MIRT2662862	hsa-miR-4781-3p	CLIP-seq
MIRT2369214	hsa-miR-4790-3p	CLIP-seq
MIRT2662863	hsa-miR-4793-5p	CLIP-seq
MIRT2662864	hsa-miR-4795-3p	CLIP-seq
MIRT2662865	hsa-miR-4796-3p	CLIP-seq
MIRT2434809	hsa-miR-4796-5p	CLIP-seq
MIRT2434810	hsa-miR-4799-5p	CLIP-seq
MIRT2662866	hsa-miR-4800-3p	CLIP-seq
MIRT2662867	hsa-miR-4800-5p	CLIP-seq
MIRT2662868	hsa-miR-487a	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2434811	hsa-miR-497	CLIP-seq
MIRT2662869	hsa-miR-498	CLIP-seq
MIRT2434812	hsa-miR-503	CLIP-seq
MIRT2662870	hsa-miR-507	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT2662871	hsa-miR-515-5p	CLIP-seq
MIRT2662872	hsa-miR-517a	CLIP-seq
MIRT2662873	hsa-miR-517c	CLIP-seq
MIRT2662874	hsa-miR-519d	CLIP-seq
MIRT2662875	hsa-miR-520f	CLIP-seq
MIRT2434816	hsa-miR-539	CLIP-seq
MIRT2434817	hsa-miR-544	CLIP-seq
MIRT2662876	hsa-miR-548a-3p	CLIP-seq
MIRT2662877	hsa-miR-548aa	CLIP-seq
MIRT2662878	hsa-miR-548ac	CLIP-seq
MIRT2662879	hsa-miR-548ae	CLIP-seq
MIRT2434819	hsa-miR-548ah	CLIP-seq
MIRT2662880	hsa-miR-548aj	CLIP-seq
MIRT2662881	hsa-miR-548am	CLIP-seq
MIRT2662882	hsa-miR-548c-3p	CLIP-seq
MIRT2662883	hsa-miR-548d-3p	CLIP-seq
MIRT2662884	hsa-miR-548e	CLIP-seq
MIRT2662885	hsa-miR-548f	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2662886	hsa-miR-548k	CLIP-seq
MIRT2434822	hsa-miR-548n	CLIP-seq
MIRT2662887	hsa-miR-548p	CLIP-seq
MIRT2434823	hsa-miR-548t	CLIP-seq
MIRT2662888	hsa-miR-548x	CLIP-seq
MIRT2662889	hsa-miR-548z	CLIP-seq
MIRT2662890	hsa-miR-550a	CLIP-seq
MIRT2662891	hsa-miR-557	CLIP-seq
MIRT2662892	hsa-miR-561	CLIP-seq
MIRT2662893	hsa-miR-564	CLIP-seq
MIRT2662894	hsa-miR-568	CLIP-seq
MIRT2434825	hsa-miR-576-3p	CLIP-seq
MIRT2434826	hsa-miR-576-5p	CLIP-seq
MIRT2441701	hsa-miR-577	CLIP-seq
MIRT2662895	hsa-miR-580	CLIP-seq
MIRT2662896	hsa-miR-583	CLIP-seq
MIRT2662897	hsa-miR-586	CLIP-seq
MIRT2434827	hsa-miR-587	CLIP-seq
MIRT2662898	hsa-miR-589	CLIP-seq
MIRT2662899	hsa-miR-595	CLIP-seq
MIRT2662900	hsa-miR-599	CLIP-seq
MIRT2434828	hsa-miR-604	CLIP-seq
MIRT2434829	hsa-miR-606	CLIP-seq
MIRT2434831	hsa-miR-616	CLIP-seq
MIRT2434832	hsa-miR-621	CLIP-seq
MIRT2662901	hsa-miR-624	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2434833	hsa-miR-629	CLIP-seq
MIRT2662902	hsa-miR-635	CLIP-seq
MIRT2434835	hsa-miR-646	CLIP-seq
MIRT2434836	hsa-miR-647	CLIP-seq
MIRT2662903	hsa-miR-649	CLIP-seq
MIRT2434837	hsa-miR-660	CLIP-seq
MIRT2434838	hsa-miR-676	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2662904	hsa-miR-762	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2434840	hsa-miR-892b	CLIP-seq
MIRT2662905	hsa-miR-93	CLIP-seq
MIRT2441702	hsa-miR-936	CLIP-seq
MIRT2662906	hsa-miR-96	CLIP-seq
MIRT2662774	hsa-miR-106a	CLIP-seq
MIRT2662775	hsa-miR-106b	CLIP-seq
MIRT2369203	hsa-miR-1178	CLIP-seq
MIRT2434717	hsa-miR-1184	CLIP-seq
MIRT2434718	hsa-miR-1205	CLIP-seq
MIRT2662776	hsa-miR-1208	CLIP-seq
MIRT2662777	hsa-miR-1236	CLIP-seq
MIRT2695258	hsa-miR-1238	CLIP-seq
MIRT2662778	hsa-miR-1243	CLIP-seq
MIRT2695259	hsa-miR-1252	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2434721	hsa-miR-1264	CLIP-seq
MIRT2441685	hsa-miR-1266	CLIP-seq
MIRT2662779	hsa-miR-1269	CLIP-seq
MIRT2662780	hsa-miR-1269b	CLIP-seq
MIRT2662781	hsa-miR-1271	CLIP-seq
MIRT2434722	hsa-miR-1272	CLIP-seq
MIRT2662782	hsa-miR-1273e	CLIP-seq
MIRT2662783	hsa-miR-1276	CLIP-seq
MIRT2662784	hsa-miR-1279	CLIP-seq
MIRT2441686	hsa-miR-128	CLIP-seq
MIRT2662786	hsa-miR-129-5p	CLIP-seq
MIRT2434724	hsa-miR-1297	CLIP-seq
MIRT2434725	hsa-miR-1298	CLIP-seq
MIRT2662787	hsa-miR-1321	CLIP-seq
MIRT2434729	hsa-miR-1322	CLIP-seq
MIRT2662788	hsa-miR-141	CLIP-seq
MIRT2662789	hsa-miR-146a	CLIP-seq
MIRT2662790	hsa-miR-146b-5p	CLIP-seq
MIRT2662791	hsa-miR-147	CLIP-seq
MIRT2695260	hsa-miR-154	CLIP-seq
MIRT2662792	hsa-miR-1587	CLIP-seq
MIRT2434731	hsa-miR-15a	CLIP-seq
MIRT2434732	hsa-miR-15b	CLIP-seq
MIRT2434733	hsa-miR-16	CLIP-seq
MIRT2662793	hsa-miR-17	CLIP-seq
MIRT2662794	hsa-miR-182	CLIP-seq
MIRT2662795	hsa-miR-186	CLIP-seq
MIRT2662796	hsa-miR-188-5p	CLIP-seq
MIRT2695261	hsa-miR-190	CLIP-seq
MIRT2695262	hsa-miR-190b	CLIP-seq
MIRT2662797	hsa-miR-1914	CLIP-seq
MIRT2434734	hsa-miR-195	CLIP-seq
MIRT2441687	hsa-miR-199a-3p	CLIP-seq
MIRT2441688	hsa-miR-199b-3p	CLIP-seq
MIRT2662798	hsa-miR-200a	CLIP-seq
MIRT2662799	hsa-miR-2052	CLIP-seq
MIRT2662800	hsa-miR-2053	CLIP-seq
MIRT2662801	hsa-miR-20a	CLIP-seq
MIRT2662802	hsa-miR-20b	CLIP-seq
MIRT2434735	hsa-miR-2110	CLIP-seq
MIRT2662803	hsa-miR-2113	CLIP-seq
MIRT2434737	hsa-miR-2355-3p	CLIP-seq
MIRT2434738	hsa-miR-26a	CLIP-seq
MIRT2434739	hsa-miR-26b	CLIP-seq
MIRT2434740	hsa-miR-298	CLIP-seq
MIRT2434741	hsa-miR-300	CLIP-seq
MIRT2434742	hsa-miR-3064-5p	CLIP-seq
MIRT2662804	hsa-miR-3117-5p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2695263	hsa-miR-3124-3p	CLIP-seq
MIRT2662805	hsa-miR-3129-3p	CLIP-seq
MIRT2441689	hsa-miR-3129-5p	CLIP-seq
MIRT2662806	hsa-miR-3133	CLIP-seq
MIRT2434745	hsa-miR-3140-3p	CLIP-seq
MIRT2463544	hsa-miR-3144-5p	CLIP-seq
MIRT2695264	hsa-miR-3145-3p	CLIP-seq
MIRT2662808	hsa-miR-3148	CLIP-seq
MIRT2662809	hsa-miR-3149	CLIP-seq
MIRT2434747	hsa-miR-3156-5p	CLIP-seq
MIRT2434748	hsa-miR-3158-5p	CLIP-seq
MIRT2662810	hsa-miR-3159	CLIP-seq
MIRT2434749	hsa-miR-3160-5p	CLIP-seq
MIRT2662811	hsa-miR-3161	CLIP-seq
MIRT2434750	hsa-miR-3163	CLIP-seq
MIRT2434751	hsa-miR-3173-5p	CLIP-seq
MIRT2695265	hsa-miR-3184	CLIP-seq
MIRT2662812	hsa-miR-3190	CLIP-seq
MIRT2695266	hsa-miR-3191	CLIP-seq
MIRT2695267	hsa-miR-3192	CLIP-seq
MIRT2148800	hsa-miR-3198	CLIP-seq
MIRT2662813	hsa-miR-3200-3p	CLIP-seq
MIRT2662814	hsa-miR-3200-5p	CLIP-seq
MIRT2662815	hsa-miR-3202	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2695268	hsa-miR-326	CLIP-seq
MIRT2695269	hsa-miR-330-5p	CLIP-seq
MIRT2662816	hsa-miR-33a	CLIP-seq
MIRT2662817	hsa-miR-33b	CLIP-seq
MIRT2434756	hsa-miR-34b	CLIP-seq
MIRT2434757	hsa-miR-3607-3p	CLIP-seq
MIRT2434758	hsa-miR-3609	CLIP-seq
MIRT2695270	hsa-miR-3613-3p	CLIP-seq
MIRT2434759	hsa-miR-3622b-5p	CLIP-seq
MIRT2434760	hsa-miR-3647-3p	CLIP-seq
MIRT2434761	hsa-miR-365	CLIP-seq
MIRT2434762	hsa-miR-3655	CLIP-seq
MIRT1493821	hsa-miR-3663-5p	CLIP-seq
MIRT2441690	hsa-miR-3664-3p	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2434763	hsa-miR-3667-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2434765	hsa-miR-3675-3p	CLIP-seq
MIRT2662818	hsa-miR-3677-5p	CLIP-seq
MIRT2662819	hsa-miR-3684	CLIP-seq
MIRT2695271	hsa-miR-3689a-5p	CLIP-seq
MIRT2695272	hsa-miR-3689b	CLIP-seq
MIRT2695273	hsa-miR-3689e	CLIP-seq
MIRT2695274	hsa-miR-3689f	CLIP-seq
MIRT2662820	hsa-miR-369-3p	CLIP-seq
MIRT2434767	hsa-miR-370	CLIP-seq
MIRT2662821	hsa-miR-374a	CLIP-seq
MIRT2662822	hsa-miR-374b	CLIP-seq
MIRT2434770	hsa-miR-381	CLIP-seq
MIRT2662823	hsa-miR-3915	CLIP-seq
MIRT2434771	hsa-miR-3919	CLIP-seq
MIRT2662824	hsa-miR-3920	CLIP-seq
MIRT2662825	hsa-miR-3928	CLIP-seq
MIRT2695275	hsa-miR-3936	CLIP-seq
MIRT2441691	hsa-miR-3941	CLIP-seq
MIRT2662826	hsa-miR-3977	CLIP-seq
MIRT2434772	hsa-miR-3978	CLIP-seq
MIRT2662827	hsa-miR-409-3p	CLIP-seq
MIRT2441692	hsa-miR-421	CLIP-seq
MIRT2695276	hsa-miR-423-5p	CLIP-seq
MIRT2434773	hsa-miR-424	CLIP-seq
MIRT2662828	hsa-miR-4251	CLIP-seq
MIRT2434774	hsa-miR-4263	CLIP-seq
MIRT2662829	hsa-miR-4265	CLIP-seq
MIRT2434777	hsa-miR-4271	CLIP-seq
MIRT2662830	hsa-miR-4275	CLIP-seq
MIRT2434778	hsa-miR-4290	CLIP-seq
MIRT2662831	hsa-miR-4296	CLIP-seq
MIRT2662832	hsa-miR-4297	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2434779	hsa-miR-4305	CLIP-seq
MIRT2148804	hsa-miR-4309	CLIP-seq
MIRT2434780	hsa-miR-4310	CLIP-seq
MIRT2662833	hsa-miR-4311	CLIP-seq
MIRT2695277	hsa-miR-4314	CLIP-seq
MIRT2148805	hsa-miR-432	CLIP-seq
MIRT2662834	hsa-miR-4322	CLIP-seq
MIRT2695278	hsa-miR-433	CLIP-seq
MIRT2662835	hsa-miR-4417	CLIP-seq
MIRT2369208	hsa-miR-4420	CLIP-seq
MIRT1493824	hsa-miR-4422	CLIP-seq
MIRT2441693	hsa-miR-4433	CLIP-seq
MIRT2662836	hsa-miR-4445	CLIP-seq
MIRT2662837	hsa-miR-4446-5p	CLIP-seq
MIRT2441694	hsa-miR-4459	CLIP-seq
MIRT2662838	hsa-miR-4464	CLIP-seq
MIRT2434784	hsa-miR-4465	CLIP-seq
MIRT2662839	hsa-miR-4470	CLIP-seq
MIRT2662840	hsa-miR-4473	CLIP-seq
MIRT2434786	hsa-miR-4477a	CLIP-seq
MIRT2662841	hsa-miR-4492	CLIP-seq
MIRT2662842	hsa-miR-4498	CLIP-seq
MIRT2662843	hsa-miR-450b-5p	CLIP-seq
MIRT2695279	hsa-miR-4517	CLIP-seq
MIRT2441695	hsa-miR-4518	CLIP-seq
MIRT2369209	hsa-miR-452	CLIP-seq
MIRT2695280	hsa-miR-4520b-3p	CLIP-seq
MIRT2434791	hsa-miR-4524	CLIP-seq
MIRT2662845	hsa-miR-4527	CLIP-seq
MIRT2695281	hsa-miR-4528	CLIP-seq
MIRT2695282	hsa-miR-4529-3p	CLIP-seq
MIRT1493827	hsa-miR-455-5p	CLIP-seq
MIRT2662846	hsa-miR-4637	CLIP-seq
MIRT2662847	hsa-miR-4640-5p	CLIP-seq
MIRT2662848	hsa-miR-4642	CLIP-seq
MIRT2434792	hsa-miR-4646-5p	CLIP-seq
MIRT2695283	hsa-miR-4652-5p	CLIP-seq
MIRT2148807	hsa-miR-4653-3p	CLIP-seq
MIRT1493828	hsa-miR-4656	CLIP-seq
MIRT2695284	hsa-miR-4659a-3p	CLIP-seq
MIRT2695285	hsa-miR-4659b-3p	CLIP-seq
MIRT2441696	hsa-miR-466	CLIP-seq
MIRT2434793	hsa-miR-4666-3p	CLIP-seq
MIRT2434795	hsa-miR-4667-5p	CLIP-seq
MIRT2662849	hsa-miR-4671-3p	CLIP-seq
MIRT2441697	hsa-miR-4672	CLIP-seq
MIRT2662850	hsa-miR-4674	CLIP-seq
MIRT2662851	hsa-miR-4675	CLIP-seq
MIRT2369210	hsa-miR-4676-3p	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2695286	hsa-miR-4691-5p	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2434798	hsa-miR-4700-5p	CLIP-seq
MIRT2441698	hsa-miR-4709-5p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2434799	hsa-miR-4716-5p	CLIP-seq
MIRT2434800	hsa-miR-4724-3p	CLIP-seq
MIRT2434801	hsa-miR-4725-3p	CLIP-seq
MIRT2662852	hsa-miR-4726-5p	CLIP-seq
MIRT2695287	hsa-miR-4729	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT2662853	hsa-miR-4738-3p	CLIP-seq
MIRT2662854	hsa-miR-4739	CLIP-seq
MIRT2662856	hsa-miR-4741	CLIP-seq
MIRT2434804	hsa-miR-4747-5p	CLIP-seq
MIRT2662857	hsa-miR-4748	CLIP-seq
MIRT2662858	hsa-miR-4752	CLIP-seq
MIRT2662859	hsa-miR-4756-5p	CLIP-seq
MIRT756276	hsa-miR-4757-3p	CLIP-seq
MIRT2434806	hsa-miR-4760-3p	CLIP-seq
MIRT2434807	hsa-miR-4764-5p	CLIP-seq
MIRT2662860	hsa-miR-4766-3p	CLIP-seq
MIRT2441699	hsa-miR-4768-3p	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2695288	hsa-miR-4775	CLIP-seq
MIRT2662861	hsa-miR-4778-3p	CLIP-seq
MIRT2662862	hsa-miR-4781-3p	CLIP-seq
MIRT2369214	hsa-miR-4790-3p	CLIP-seq
MIRT2662863	hsa-miR-4793-5p	CLIP-seq
MIRT2662864	hsa-miR-4795-3p	CLIP-seq
MIRT2662865	hsa-miR-4796-3p	CLIP-seq
MIRT2434809	hsa-miR-4796-5p	CLIP-seq
MIRT2434810	hsa-miR-4799-5p	CLIP-seq
MIRT2662866	hsa-miR-4800-3p	CLIP-seq
MIRT2662868	hsa-miR-487a	CLIP-seq
MIRT2695289	hsa-miR-491-3p	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2434811	hsa-miR-497	CLIP-seq
MIRT2662869	hsa-miR-498	CLIP-seq
MIRT2434812	hsa-miR-503	CLIP-seq
MIRT2662870	hsa-miR-507	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT2695290	hsa-miR-513a-3p	CLIP-seq
MIRT2662871	hsa-miR-515-5p	CLIP-seq
MIRT2662872	hsa-miR-517a	CLIP-seq
MIRT2662873	hsa-miR-517c	CLIP-seq
MIRT2662874	hsa-miR-519d	CLIP-seq
MIRT2662875	hsa-miR-520f	CLIP-seq
MIRT2434816	hsa-miR-539	CLIP-seq
MIRT2434817	hsa-miR-544	CLIP-seq
MIRT2662876	hsa-miR-548a-3p	CLIP-seq
MIRT2662877	hsa-miR-548aa	CLIP-seq
MIRT2662878	hsa-miR-548ac	CLIP-seq
MIRT2662879	hsa-miR-548ae	CLIP-seq
MIRT2434819	hsa-miR-548ah	CLIP-seq
MIRT2662880	hsa-miR-548aj	CLIP-seq
MIRT2662881	hsa-miR-548am	CLIP-seq
MIRT2662882	hsa-miR-548c-3p	CLIP-seq
MIRT2662883	hsa-miR-548d-3p	CLIP-seq
MIRT2662884	hsa-miR-548e	CLIP-seq
MIRT2662885	hsa-miR-548f	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2662886	hsa-miR-548k	CLIP-seq
MIRT2434822	hsa-miR-548n	CLIP-seq
MIRT2662887	hsa-miR-548p	CLIP-seq
MIRT2434823	hsa-miR-548t	CLIP-seq
MIRT2662888	hsa-miR-548x	CLIP-seq
MIRT2662889	hsa-miR-548z	CLIP-seq
MIRT2662890	hsa-miR-550a	CLIP-seq
MIRT2695291	hsa-miR-556-5p	CLIP-seq
MIRT2662891	hsa-miR-557	CLIP-seq
MIRT2662892	hsa-miR-561	CLIP-seq
MIRT2662893	hsa-miR-564	CLIP-seq
MIRT2662894	hsa-miR-568	CLIP-seq
MIRT2434825	hsa-miR-576-3p	CLIP-seq
MIRT2434826	hsa-miR-576-5p	CLIP-seq
MIRT2441701	hsa-miR-577	CLIP-seq
MIRT2695292	hsa-miR-579	CLIP-seq
MIRT2662895	hsa-miR-580	CLIP-seq
MIRT2662896	hsa-miR-583	CLIP-seq
MIRT2662897	hsa-miR-586	CLIP-seq
MIRT2434827	hsa-miR-587	CLIP-seq
MIRT2662898	hsa-miR-589	CLIP-seq
MIRT2662899	hsa-miR-595	CLIP-seq
MIRT2662900	hsa-miR-599	CLIP-seq
MIRT2434828	hsa-miR-604	CLIP-seq
MIRT2434829	hsa-miR-606	CLIP-seq
MIRT2695293	hsa-miR-610	CLIP-seq
MIRT2434831	hsa-miR-616	CLIP-seq
MIRT2434832	hsa-miR-621	CLIP-seq
MIRT2662901	hsa-miR-624	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2434833	hsa-miR-629	CLIP-seq
MIRT2662902	hsa-miR-635	CLIP-seq
MIRT2695294	hsa-miR-637	CLIP-seq
MIRT2434835	hsa-miR-646	CLIP-seq
MIRT2434836	hsa-miR-647	CLIP-seq
MIRT2662903	hsa-miR-649	CLIP-seq
MIRT2434837	hsa-miR-660	CLIP-seq
MIRT2434838	hsa-miR-676	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2662904	hsa-miR-762	CLIP-seq
MIRT2434839	hsa-miR-767-5p	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2434840	hsa-miR-892b	CLIP-seq
MIRT2662905	hsa-miR-93	CLIP-seq
MIRT2441702	hsa-miR-936	CLIP-seq
MIRT2695295	hsa-miR-942	CLIP-seq
MIRT2662906	hsa-miR-96	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CUX1	Activation	17227781;23359789
HOXB7	Activation	21183939
PITX2	Unknown	23250740

232

Show/Hide all (232)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001736	Process	Establishment of planar polarity	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEP	12841867
GO:0001843	Process	Neural tube closure	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	17986384
GO:0001947	Process	Heart looping	IEA
GO:0002009	Process	Morphogenesis of an epithelium	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS	16258938
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IMP	18174455
GO:0003138	Process	Primary heart field specification	IEA
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003283	Process	Atrial septum development	IEA
GO:0003323	Process	Type B pancreatic cell development	IEA
GO:0003344	Process	Pericardium morphogenesis	IEA
GO:0003401	Process	Axis elongation	IEA
GO:0003408	Process	Optic cup formation involved in camera-type eye development	ISS	16258938
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IEA
GO:0005109	Function	Frizzled binding	IPI	18174455
GO:0005109	Function	Frizzled binding	TAS	25424568
GO:0005115	Function	Receptor tyrosine kinase-like orphan receptor binding	IPI	18287027
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	22784633, 26342861, 33961781, 34731008, 36994853
GO:0005543	Function	Phospholipid binding	TAS	25424568
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	25424568
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18703641, 19048125, 20034610
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IMP	31512787
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	19099253
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	IEA
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	IMP	17986384
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	NAS	24431302
GO:0007254	Process	JNK cascade	IEA
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0007442	Process	Hindgut morphogenesis	IEA
GO:0007494	Process	Midgut development	IEA
GO:0008104	Process	Intracellular protein localization	IDA	19177143
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008584	Process	Male gonad development	IEP	17848411
GO:0008595	Process	Anterior/posterior axis specification, embryo	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	17035633, 17986384
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010742	Process	Macrophage derived foam cell differentiation	IMP	31512787
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	19520808
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016055	Process	Wnt signaling pathway	IDA	20034610
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016477	Process	Cell migration	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021891	Process	Olfactory bulb interneuron development	IEA
GO:0021891	Process	Olfactory bulb interneuron development	ISS
GO:0021915	Process	Neural tube development	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030216	Process	Keratinocyte differentiation	IEP	19399181
GO:0030324	Process	Lung development	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030901	Process	Midbrain development	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IEA
GO:0032722	Process	Positive regulation of chemokine production	IMP	19520808
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	18174455
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	18174455
GO:0032757	Process	Positive regulation of interleukin-8 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032880	Process	Regulation of protein localization	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035108	Process	Limb morphogenesis	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	TAS	24449494
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0036517	Process	Chemoattraction of serotonergic neuron axon	IEA
GO:0036517	Process	Chemoattraction of serotonergic neuron axon	ISS
GO:0036518	Process	Chemorepulsion of dopaminergic neuron axon	IEA
GO:0036518	Process	Chemorepulsion of dopaminergic neuron axon	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042060	Process	Wound healing	IDA	19878652
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IMP	18174455
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19251946
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	20032469
GO:0045165	Process	Cell fate commitment	IBA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IMP	20032469
GO:0045732	Process	Positive regulation of protein catabolic process	IGI	12952940
GO:0045766	Process	Positive regulation of angiogenesis	IMP	17035633
GO:0045778	Process	Positive regulation of ossification	IMP	20032469
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0045836	Process	Positive regulation of meiotic nuclear division	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19277043
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19847889
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18174455
GO:0046330	Process	Positive regulation of JNK cascade	IDA	20034610
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046546	Process	Development of primary male sexual characteristics	IEA
GO:0048018	Function	Receptor ligand activity	IC	18174455
GO:0048022	Process	Negative regulation of melanin biosynthetic process	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	19251946
GO:0048341	Process	Paraxial mesoderm formation	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048570	Process	Notochord morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IMP	19918918
GO:0048806	Process	Genitalia development	IMP	19918918
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0048846	Process	Axon extension involved in axon guidance	IEA
GO:0048850	Process	Hypophysis morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	NAS	21857966
GO:0050729	Process	Positive regulation of inflammatory response	IMP	18174455
GO:0050807	Process	Regulation of synapse organization	IDA	18986540
GO:0050807	Process	Regulation of synapse organization	IMP	18986540
GO:0050919	Process	Negative chemotaxis	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0051885	Process	Positive regulation of timing of anagen	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20034610
GO:0051964	Process	Negative regulation of synapse assembly	IEA
GO:0060026	Process	Convergent extension	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060029	Process	Convergent extension involved in organogenesis	IEA
GO:0060065	Process	Uterus development	IEA
GO:0060067	Process	Cervix development	IEA
GO:0060068	Process	Vagina development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	ISS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS	22988876, 23517308, 24431302
GO:0060157	Process	Urinary bladder development	IEA
GO:0060324	Process	Face development	IMP	19918918
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	19399181
GO:0060599	Process	Lateral sprouting involved in mammary gland duct morphogenesis	IEA
GO:0060606	Process	Tube closure	IEA
GO:0060638	Process	Mesenchymal-epithelial cell signaling	IEA
GO:0060686	Process	Negative regulation of prostatic bud formation	IEA
GO:0060744	Process	Mammary gland branching involved in thelarche	IEA
GO:0060750	Process	Epithelial cell proliferation involved in mammary gland duct elongation	IEA
GO:0060760	Process	Positive regulation of response to cytokine stimulus	IDA	19399181
GO:0060762	Process	Regulation of branching involved in mammary gland duct morphogenesis	IEA
GO:0060809	Process	Mesodermal to mesenchymal transition involved in gastrulation	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IMP	18174455
GO:0061036	Process	Positive regulation of cartilage development	IEA
GO:0061053	Process	Somite development	IEA
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070062	Component	Extracellular exosome	TAS
GO:0070242	Process	Thymocyte apoptotic process	IEA
GO:0070245	Process	Positive regulation of thymocyte apoptotic process	IEA
GO:0071219	Process	Cellular response to molecule of bacterial origin	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEP	18174455
GO:0071277	Process	Cellular response to calcium ion	IEP	18703641
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071346	Process	Cellular response to type II interferon	IEP	18174455
GO:0071425	Process	Hematopoietic stem cell proliferation	IDA	9787155
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	IDA	19878652
GO:0090009	Process	Primitive streak formation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	12952940
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0097325	Process	Melanocyte proliferation	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IDA	18986540, 27402827
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	18986540, 27402827
GO:0099054	Process	Presynapse assembly	TAS	24449494
GO:0099068	Process	Postsynapse assembly	TAS	24449494
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:0099175	Process	Regulation of postsynapse organization	IDA	27402827
GO:0099175	Process	Regulation of postsynapse organization	IMP	27402827
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IDA	27402827
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IMP	27402827
GO:0140013	Process	Meiotic nuclear division	IEA
GO:0150012	Process	Positive regulation of neuron projection arborization	IEA
GO:0150012	Process	Positive regulation of neuron projection arborization	ISS
GO:1900020	Process	Positive regulation of protein kinase C activity	IMP	12086864
GO:1902035	Process	Positive regulation of hematopoietic stem cell proliferation	IEA
GO:1902379	Function	Chemoattractant activity involved in axon guidance	IEA
GO:1902474	Process	Positive regulation of protein localization to synapse	TAS	24449494
GO:1904861	Process	Excitatory synapse assembly	TAS	24449494
GO:1904862	Process	Inhibitory synapse assembly	TAS	24449494
GO:1904934	Process	Negative regulation of cell proliferation in midbrain	IEA
GO:1904934	Process	Negative regulation of cell proliferation in midbrain	NAS	24431302
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	TAS	22988876
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
164975	12784	ENSG00000114251

P41221

Protein name

Protein Wnt-5a

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhib

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	71 → 380	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protei

Sequence

MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Axon guidance Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		TCF dependent signaling in response to WNT WNT ligand biogenesis and trafficking Ca2+ pathway PCP/CE pathway Asymmetric localization of PCP proteins WNT5A-dependent internalization of FZD4 WNT5A-dependent internalization of FZD2, FZD5 and ROR2 Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis WNT5:FZD7-mediated leishmania damping

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant Robinow syndrome 1	Pathogenic; Likely pathogenic	rs786204837, rs786204836, rs387906663, rs786200925, rs1553677971, rs2106946273	RCV001376107 RCV000169740 RCV000022695 RCV000022696 RCV000577882 RCV001353076 RCV001353077

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Conflicting classifications of pathogenicity	rs188798140	RCV005888283
Short stature	Uncertain significance	rs963662325	RCV003529920
WNT5A-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign; Uncertain significance	rs2106945723, rs188798140, rs771114367, rs756458693, rs181894008, rs200868061, rs751084010, rs2051227861, rs1359294973, rs117338660, rs756403639, rs775072555, rs2471282057, rs752929793, rs376719937, rs755298573 View all (1 more)	RCV003938861 RCV003968822 RCV003895876 RCV004754852 RCV003965115 RCV003977459 RCV003943442 RCV003405948 RCV003400101 RCV003957793 RCV003981110 RCV003956580 RCV003982552 RCV003902097 RCV003957114 RCV003969282

Show/Hide Text Mining Associations (211)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	35239776
Acute On Chronic Liver Failure	Associate	38062395
Adenocarcinoma	Associate	27084312, 28465645
Adenoma	Stimulate	10507776
Adenoma	Associate	27245242
Adenomatous Polyposis Coli	Inhibit	17463182
Amyotrophic Lateral Sclerosis	Associate	30924074
Aortic Dissection	Associate	36959563
Arthritis Psoriatic	Associate	35055107
Arthritis Rheumatoid	Associate	10688908, 11315916, 33178184, 34211463
Asthma	Associate	27297409, 33303529
Atherosclerosis	Associate	24346141, 33818249, 35282771
Bone Marrow Diseases	Associate	20465808
Brain Neoplasms	Associate	29110584
Breast Neoplasms	Associate	15868903, 16330545, 16569699, 16880514, 16914445, 19244247, 21871017, 22547701, 23990917, 24260410, 24293407, 25204426, 27500936, 29207169, 34047951, 36476423, 37029329, 9367869 View all (3 more)
Breast Neoplasms	Stimulate	22655072, 23679576
Breast Neoplasms	Inhibit	22939885, 23417837, 27623766
Calcinosis	Associate	37427430
Calcinosis Cutis	Associate	16880514, 19244247
Calcinosis Cutis	Stimulate	31903136
Cap Myopathy	Associate	24518599
Carcinogenesis	Associate	22293903, 22966878, 23349696, 24351810, 24416340, 24865425, 31198984, 35595735, 36476423
Carcinogenesis	Inhibit	29487190
Carcinoma Adenosquamous	Associate	28465645
Carcinoma Basal Cell	Stimulate	11348463, 22384081
Carcinoma Embryonal	Associate	19874621
Carcinoma Hepatocellular	Associate	18477650, 18577996, 19849855, 22493546, 25031739, 37814183
Carcinoma Non Small Cell Lung	Associate	23349696, 35692887, 36102318
Carcinoma Non Small Cell Lung	Stimulate	24999479, 26305508
Carcinoma Ovarian Epithelial	Associate	24351810, 24785108, 30079293
Carcinoma Pancreatic Ductal	Associate	31557131, 34565024, 37914721
Carcinoma Renal Cell	Associate	33804101, 37173306, 9679734
Carcinoma Squamous Cell	Associate	12841867, 23505429, 36867945
Carcinoma Squamous Cell	Stimulate	22384081, 24999479, 28340578, 35850748
Cardiovascular Diseases	Associate	22485170
Cartilage Diseases	Associate	28587781
Cerebral Infarction	Associate	35622188
Charcot Marie Tooth disease Type 1C	Associate	19309775
Chemical and Drug Induced Liver Injury	Associate	34198988
Cholangiocarcinoma	Associate	24549785
Chronic Periodontitis	Stimulate	22485170
Chronic Periodontitis	Associate	23459936
Cleft Lip	Associate	31172578
Cleft Palate	Associate	31262291
Colitis Ulcerative	Associate	38303405
Colonic Neoplasms	Associate	27245242, 36704936
Colorectal Neoplasms	Associate	12147710, 17463182, 21587258, 22522911, 22966878, 24504536, 24564183, 25107489, 28859077, 29160937, 29453334, 29869456, 33034614, 33125346, 33300054, 37998393, 38224823, 39385172 View all (3 more)
Colorectal Neoplasms	Inhibit	24260410, 24833087
Colorectal Neoplasms	Stimulate	32258125
Communicable Diseases	Associate	23679576
Conotruncal cardiac defects	Associate	26278011
Coronary Artery Disease	Associate	31981630
Coronary Artery Disease	Stimulate	36603481
COVID 19	Associate	35040478
Cytokine Release Syndrome	Associate	35622188
Dementia	Associate	33967051
Diabetes Mellitus	Associate	26800561, 37460827
Diabetes Mellitus Type 2	Associate	35436882
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	31902091
Dry Eye Syndromes	Associate	19011014
Dupuytren Contracture	Associate	20676061
Endometrial Neoplasms	Inhibit	31198984, 9099960
Endometrial Neoplasms	Associate	37335710
Endometriosis	Stimulate	24661731
Epidermodysplasia Verruciformis	Associate	37427430
Esophageal Neoplasms	Associate	33793074
Esophageal Squamous Cell Carcinoma	Inhibit	20603606
Esophageal Squamous Cell Carcinoma	Associate	35595735
Fatty Liver	Associate	36077270
Fetal Growth Retardation	Associate	36524356
Fibrocartilaginous embolism	Associate	29656141
Fibrosis	Associate	29955137, 33167868
Frontotemporal Lobar Degeneration	Associate	24139281
Gastrointestinal Stromal Tumors	Associate	24726140
Glioblastoma	Associate	27863244, 29110584, 29207169, 33857857, 36314076
Glioma	Associate	21205070, 27863244, 33161527, 34657400, 36314076
Glioma	Stimulate	32181818
Gliosis	Associate	35040478
Granulomatous Disease Chronic	Associate	16601243
Graves Ophthalmopathy	Associate	22554965
Growth Disorders	Associate	20465808
Heart Defects Congenital	Associate	26278011
Heart Diseases	Stimulate	28411232
Hemangioma Cavernous Central Nervous System	Stimulate	26939869
Hematologic Neoplasms	Associate	24260410, 34334378
Hemoglobin SC Disease	Associate	28465645
Hepatitis B	Associate	38062395
Hepatitis B Chronic	Stimulate	38062395
Hereditary Angioedema Type III	Associate	34047951
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	20603606
Heredodegenerative Disorders Nervous System	Associate	36553576
Hyperalgesia	Associate	35040478
Hyperplasia	Stimulate	16470182
Hypoxia	Inhibit	16914445
Hypoxia	Stimulate	36314076
Ichthyosis X Linked	Associate	30816547
Idiopathic Pulmonary Fibrosis	Associate	26538547, 26997628, 37545510
IgA Vasculitis	Associate	11315916, 33178184
Immunologic Deficiency Syndromes	Stimulate	26624524
Inflammation	Associate	16601243, 22384249, 22485170, 24416340, 24954857, 29229927, 31082802, 31235551, 33603066, 34565024, 35622188, 38062395
Inflammation	Stimulate	23679576, 27036869, 28536612, 34211463
Inflammation	Inhibit	29656141
Insulin Resistance	Associate	26800561, 29229927
Insulin Resistance	Stimulate	27688298
Internal Hernia	Associate	25913759
Intervertebral Disc Degeneration	Associate	29656141, 33090383
Intestinal Diseases	Associate	37819756
Intestinal Pseudo Obstruction	Associate	29229927
Intracranial Arterial Diseases	Stimulate	24346141
Ischemia	Associate	38139440
Joint Diseases	Associate	35436882
Lead Poisoning Nervous System	Associate	38062395
Leukemia	Associate	28923920
Leukemia Lymphocytic Chronic B Cell	Associate	26240275, 27815263, 30568170, 31409670, 31645416, 33097837, 33211804
Leukemia Lymphoma Adult T Cell	Stimulate	33603066
Leukemia Myeloid Acute	Associate	19874313, 28440495
Leukemia Myeloid Acute	Inhibit	25428027
Leukemia Prolymphocytic T Cell	Associate	35333703
Liver Cirrhosis	Associate	30871618
Liver Failure	Associate	38062395
Lung Neoplasms	Associate	23349696
Lymphatic Metastasis	Stimulate	25337253
Lymphatic Metastasis	Inhibit	26721633
Lymphatic Metastasis	Associate	30079293, 33654199, 35595735
Lymphoma	Associate	26608372
Macular Degeneration	Associate	26246285
Mammary Neoplasms Animal	Associate	27500936
Medulloblastoma	Associate	23278988
Melanoma	Associate	12086864, 14514922, 16116595, 17426020, 19099253, 19177143, 19696445, 19946729, 21494614, 23462101, 24293407, 24587766, 24766647, 24865425, 25944911 View all (6 more)
Melanoma	Stimulate	24260410, 24954857
Melanosis	Associate	21562572
Metabolic Diseases	Associate	26800561, 28411232, 29229927
Metabolic Diseases	Inhibit	31981630
Microsatellite Instability	Associate	21587258
MINOCA	Associate	38139440
Mouth Diseases	Stimulate	7759542
Mouth Neoplasms	Associate	33167868
Multiple Myeloma	Associate	20465808, 40650009
Mysophobia	Associate	22485170
Nasopharyngeal Carcinoma	Associate	25066400
Neoplasm Metastasis	Associate	15868903, 19696445, 22293903, 23462101, 24024328, 24156409, 24362328, 24766647, 25066400, 25337253, 25779663, 27139420, 29648538, 33161527, 33300054 View all (4 more)
Neoplasm Metastasis	Inhibit	17426020
Neoplasm Metastasis	Stimulate	23075330, 24156409, 35595735
Neoplasms	Stimulate	10507776, 24351810, 26055321, 32258125
Neoplasms	Associate	12147710, 16569699, 18577996, 19543744, 21172013, 21587258, 22039506, 22384081, 22493546, 22547701, 23280481, 23342259, 23679576, 23947922, 24156409 View all (35 more)
Neoplasms	Inhibit	15868903, 16880514, 18549404, 18793406, 19874313, 20603606, 23990917, 24833087, 27084312, 27500936, 29160937, 31198984, 35796028, 36622276, 37998393
Neoplasms Adipose Tissue	Stimulate	27688298
Neoplasms Adipose Tissue	Associate	29229927
Neoplasms Glandular and Epithelial	Associate	35239776
Neuroblastoma	Associate	24260410
Neurofibrosarcoma	Inhibit	34079083
Niemann Pick Disease Type C	Associate	25066400
Non alcoholic Fatty Liver Disease	Stimulate	34198988
Non alcoholic Fatty Liver Disease	Associate	36077270
Obesity	Associate	22384249, 27688298, 28272483, 28411232
Obesity	Stimulate	39837875
Obesity Morbid	Inhibit	36077270
Oculocutaneous albinism type 1B	Associate	25913759
Osteoarthritis	Inhibit	10688908
Osteoarthritis	Associate	22485170, 28587781, 28777797
Osteoarthritis Knee	Associate	27556044
Osteosarcoma	Associate	22293903, 26978652, 40616392
Ovarian Diseases	Associate	24351810
Ovarian Neoplasms	Associate	24351810, 24606488, 24785108, 28536612, 30079293, 33723319, 35053353
Pain	Associate	35040478
Pancreatic Neoplasms	Associate	18298655, 24156409, 33200805
Periapical Periodontitis	Associate	31831777
Periodontitis	Associate	27602578
Personality Disorders	Inhibit	23417837, 24833087
Pituitary Neoplasms	Associate	31655798
Plasmablastic Lymphoma	Associate	37105495
Polycystic Kidney Autosomal Recessive	Associate	30414501
Precancerous Conditions	Associate	26227219
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	22426169
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	18549404, 26316480
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17614820, 26316480
Prostatic Neoplasms	Stimulate	20454608, 22039506, 23342259, 35930737, 36623397
Prostatic Neoplasms	Associate	20603606, 24518599, 24972966, 28030815, 29453313, 31409900, 33639039, 34889941, 35131873
Prostatic Neoplasms Castration Resistant	Associate	29453313
Prostatitis	Associate	22039506
Psoriasis	Associate	20376066, 22384081, 38303405
Psychomotor Agitation	Associate	33967051
Pulmonary Disease Chronic Obstructive	Associate	27036869
Respiratory Tract Infections	Associate	35484165
Retinal Degeneration	Associate	35622188
Retinal Dysplasia	Associate	28603941
Rhabdomyosarcoma	Associate	35796028
Rhabdomyosarcoma Embryonal	Associate	35796028
Robinow Syndrome	Associate	25817016
Sarcoidosis	Associate	21146388
Sarcoma Ewing	Associate	23075330, 26739507
Schizophrenia	Associate	32143829
Sepsis	Associate	22547701, 35239776
Sepsis	Stimulate	23679576
Skin Diseases	Associate	22384081
Skin Neoplasms	Associate	22384081
Squamous Cell Carcinoma of Head and Neck	Associate	19543744, 28157427, 28559016, 28603941, 31902091, 33840648
Status Asthmaticus	Stimulate	27297409
Stomach Neoplasms	Stimulate	24260410
Stomach Neoplasms	Associate	24351810, 24416340, 25779663, 26708384, 26939869, 28560594, 30624523, 30829316, 33654199, 38240752
Stroke	Associate	35622188
Synovial Cyst	Stimulate	34211463
Tongue Diseases	Associate	28559016
Triple Negative Breast Neoplasms	Associate	26721633
Upton Young syndrome	Associate	14514922
Urethral Neoplasms	Associate	23947922, 28427201
Urinary Bladder Neoplasms	Associate	19061910, 28193625, 30032142, 31268162
Uterine Cervical Neoplasms	Stimulate	25337253
Uterine Cervical Neoplasms	Associate	38555994
Vascular Diseases	Associate	26800561
Wilms Tumor	Associate	37815464

WNT5A (Wnt family member 5A)