Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	7472
Gene name	Wnt family member 2
Gene symbol	WNT2
Synonyms (NCBI Gene)	INT1L1IRP
Chromosome	7
Chromosome location	7q31.2
Summary	This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulat

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025070	hsa-miR-181a-5p	Microarray	17612493
MIRT438595	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT438595	hsa-miR-199a-5p	Luciferase reporter assayNext Generation Sequencing (NGS)qRT-PCRWestern blot	25596533
MIRT732830	hsa-miR-30a-3p	ImmunofluorescenceLuciferase reporter assayRNA-seqWestern blotting	33397440
MIRT755966	hsa-miR-320e	Luciferase reporter assayWestern blottingqRT-PCR	37771642
MIRT1493629	hsa-miR-1321	CLIP-seq
MIRT1493630	hsa-miR-1468	CLIP-seq
MIRT1493631	hsa-miR-3160-5p	CLIP-seq
MIRT1493632	hsa-miR-4270	CLIP-seq
MIRT1493633	hsa-miR-4441	CLIP-seq
MIRT1493634	hsa-miR-4511	CLIP-seq
MIRT1493635	hsa-miR-452	CLIP-seq
MIRT1493636	hsa-miR-4676-3p	CLIP-seq
MIRT1493637	hsa-miR-4693-5p	CLIP-seq
MIRT1493638	hsa-miR-4739	CLIP-seq
MIRT1493639	hsa-miR-4756-5p	CLIP-seq
MIRT1493640	hsa-miR-548b-3p	CLIP-seq
MIRT2148786	hsa-miR-1305	CLIP-seq
MIRT2369180	hsa-miR-296-5p	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PITX2	Unknown	23250740

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS	16258938
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IPI	10557084, 19038973
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	10557084
GO:0005515	Function	Protein binding	IPI	10347172, 28514442, 33961781
GO:0005576	Component	Extracellular region	IDA	19038973
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	2971536
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	19038973, 19239325, 23610556
GO:0007267	Process	Cell-cell signaling	IDA	10557084
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10347172
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0022008	Process	Neurogenesis	TAS	24431302
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0031012	Component	Extracellular matrix	IDA	15507471
GO:0033278	Process	Cell proliferation in midbrain	IDA	20018874
GO:0033278	Process	Cell proliferation in midbrain	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10557084, 20018874
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048018	Function	Receptor ligand activity	IDA	10557084
GO:0048018	Function	Receptor ligand activity	IMP	17948129
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	19734317
GO:0048513	Process	Animal organ development	IEA
GO:0048731	Process	System development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10347172, 10557084, 20018874
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17948129
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	24431302
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0060492	Process	Lung induction	IEA
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060502	Process	Epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061072	Process	Iris morphogenesis	ISS	16258938
GO:0061180	Process	Mammary gland epithelium development	IEP	8168088
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IDA	20018874
GO:1990909	Component	Wnt signalosome	IC	10557084

MIM	HGNC	e!Ensembl
147870	12780	ENSG00000105989

P09544

Protein name

Protein Wnt-2 (Int-1-like protein 1) (Int-1-related protein) (IRP)

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20018874). Functions as a upstream reg

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	43 → 349	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain in the thalamus, in fetal and adult lung and in placenta. {ECO:0000269|PubMed:11449391}.

Sequence

MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT

Sequence length

360

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking

WNT2 (Wnt family member 2)