Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7472
Gene name Gene Name - the full gene name approved by the HGNC.	Wnt family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WNT2
Synonyms (NCBI Gene) Gene synonyms aliases	INT1L1, IRP
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q31.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulat

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025070	hsa-miR-181a-5p	Microarray	17612493
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, Western blot	25596533
MIRT732830	hsa-miR-30a-3p	Immunofluorescence, Luciferase reporter assay, RNA-seq, Western blotting	33397440
MIRT755966	hsa-miR-320e	Luciferase reporter assay, Western blotting, qRT-PCR	37771642
MIRT1493629	hsa-miR-1321	CLIP-seq
MIRT1493630	hsa-miR-1468	CLIP-seq
MIRT1493631	hsa-miR-3160-5p	CLIP-seq
MIRT1493632	hsa-miR-4270	CLIP-seq
MIRT1493633	hsa-miR-4441	CLIP-seq
MIRT1493634	hsa-miR-4511	CLIP-seq
MIRT1493635	hsa-miR-452	CLIP-seq
MIRT1493636	hsa-miR-4676-3p	CLIP-seq
MIRT1493637	hsa-miR-4693-5p	CLIP-seq
MIRT1493638	hsa-miR-4739	CLIP-seq
MIRT1493639	hsa-miR-4756-5p	CLIP-seq
MIRT1493640	hsa-miR-548b-3p	CLIP-seq
MIRT2148786	hsa-miR-1305	CLIP-seq
MIRT2369180	hsa-miR-296-5p	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PITX2	Unknown	23250740

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS	16258938
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005109	Function	Frizzled binding	IPI	10557084, 19038973
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	10557084
GO:0005515	Function	Protein binding	IPI	10347172
GO:0005576	Component	Extracellular region	NAS	2971536
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19038973, 19239325, 23610556
GO:0007267	Process	Cell-cell signaling	IDA	10557084
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10347172
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0022008	Process	Neurogenesis	TAS	24431302
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030182	Process	Neuron differentiation	ISS
GO:0030324	Process	Lung development	IEA
GO:0031232	Component	Extrinsic component of external side of plasma membrane	IDA	19038973
GO:0033278	Process	Cell proliferation in midbrain	IDA	20018874
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20018874
GO:0048018	Function	Receptor ligand activity	IDA	10557084
GO:0048018	Function	Receptor ligand activity	IMP	17948129
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	19734317
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10557084
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10347172, 10557084, 20018874
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17948129
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	24431302
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0060492	Process	Lung induction	IEA
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061072	Process	Iris morphogenesis	ISS	16258938
GO:0061180	Process	Mammary gland epithelium development	IEP	8168088
GO:0062023	Component	Collagen-containing extracellular matrix	IDA	15507471
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IDA	20018874
GO:1904954	Process	Canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	IDA	20018874
GO:1990909	Component	Wnt signalosome	IC	10557084

MIM	HGNC	e!Ensembl
147870	12780	ENSG00000105989

Protein

UniProt ID

P09544

Protein name

Protein Wnt-2 (Int-1-like protein 1) (Int-1-related protein) (IRP)

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20018874). Functions as a upstream reg

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	43 → 349	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain in the thalamus, in fetal and adult lung and in placenta. {ECO:0000269|PubMed:11449391}.

Sequence

MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT

Sequence length

360

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	19895723, 11449391
Cervical cancer	cervical cancer	rs28934571, rs121913482, rs121913483	25061499

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Uterine Fibroids	Uterine Fibroids			GWAS

Show/Hide Text Mining Associations (61)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Stimulate	10507776
Adenoma	Associate	34477243
Asthma	Associate	29505605
Auditory Perceptual Disorders	Inhibit	28081867
Autism Spectrum Disorder	Associate	34862305
Autistic Disorder	Associate	19895723, 28081867
Breast Neoplasms	Associate	15736421, 21772333
Bronchopulmonary Dysplasia	Associate	30459472
Carcinogenesis	Associate	15736421
Carcinoma Hepatocellular	Associate	28328801, 31322232
Carcinoma Non Small Cell Lung	Associate	34666560
Carcinoma Renal Cell	Associate	33804101
Cardiomyopathies	Associate	29207102
Cerebral Cortical Thinning	Associate	34862305
Colonic Neoplasms	Associate	29393333
Colorectal Neoplasms	Associate	12147710, 18600204, 24504536, 26484565, 29202761, 31468733, 31667643, 33155209, 33891491, 35448980, 36734282, 37374338
Craniosynostoses	Associate	22028906
Cystic Fibrosis	Associate	2565082, 2902786
Donohue Syndrome	Associate	20033851
Drug Related Side Effects and Adverse Reactions	Associate	16386771
Dupuytren Contracture	Associate	21732829
Endometrial Neoplasms	Inhibit	9099960
Endometriosis	Associate	22259059
Esophageal Squamous Cell Carcinoma	Associate	22499122, 26045816
Factor V Deficiency	Associate	20364084
Fetal Growth Retardation	Stimulate	26678531
Gallbladder Diseases	Associate	26111189
Glucosephosphate Dehydrogenase Deficiency	Associate	31667643
Growth Hormone Secreting Pituitary Adenoma	Associate	31432167
Helicobacter Infections	Stimulate	39616478
Hemochromatosis	Associate	12393473, 9116301, 9516158
Heterotaxy Syndrome	Associate	26111189
Hyperferritinemia hereditary with congenital cataracts	Associate	10473603
Hypoxia	Associate	29207102
Inflammation	Inhibit	9516158
Intestinal Neoplasms	Associate	34274970
Klatskin Tumor	Associate	26972709
Lung Neoplasms	Associate	12937339
Lymphatic Metastasis	Associate	21319141, 27513465, 31468733
Melanoma	Stimulate	19332774
Myostatin related muscle hypertrophy	Associate	29505605
Neoplasm Invasiveness	Associate	31468733
Neoplasm Metastasis	Associate	27513465, 31667643
Neoplasms	Associate	12147710, 18478098, 26484565, 27513465, 28328801, 28665975, 29202761, 31468733, 31667643, 34666560
Neoplasms	Stimulate	15736421, 18600204
Neoplasms	Inhibit	17643369
Neoplastic Syndromes Hereditary	Associate	23421845
Neuroendocrine Tumors	Associate	34274970
Osteosarcoma	Associate	28665975
Ovarian Neoplasms	Associate	23250740
Pediatric Obesity	Associate	30459472
Polyps	Associate	34477243
Prostatic Neoplasms	Associate	18478098
Prostatitis	Associate	18478098
Rufous oculocutaneous albinism	Associate	28328801
Signs and Symptoms	Associate	28081867
Status Asthmaticus	Associate	29505605
Stomach Neoplasms	Associate	33002344, 35929139, 39616478
Upton Young syndrome	Associate	14514922
Uterine Cervical Neoplasms	Associate	21319141, 32058219
Uterine Cervical Neoplasms	Stimulate	27513465

WNT2 (Wnt family member 2)