Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7453
Gene name Gene Name - the full gene name approved by the HGNC.	Tryptophanyl-tRNA synthetase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WARS1
Synonyms (NCBI Gene) Gene synonyms aliases	GAMMA-2, HMN9, HMND9, IFI53, IFP53, NEDMSBA, WARS
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first prot

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs770003315	T>A,C	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0004812	Function	Aminoacyl-tRNA ligase activity	IEA
GO:0004830	Function	Tryptophan-tRNA ligase activity	IBA
GO:0004830	Function	Tryptophan-tRNA ligase activity	IEA
GO:0004830	Function	Tryptophan-tRNA ligase activity	IMP	28369220
GO:0004830	Function	Tryptophan-tRNA ligase activity	NAS	8496617
GO:0005515	Function	Protein binding	IPI	15628863, 20010843, 21044950, 22504299, 39232006
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	22504299
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	1761529, 16130169
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	TAS	1761529
GO:0006418	Process	TRNA aminoacylation for protein translation	IEA
GO:0006436	Process	Tryptophanyl-tRNA aminoacylation	IBA
GO:0006436	Process	Tryptophanyl-tRNA aminoacylation	IEA
GO:0006436	Process	Tryptophanyl-tRNA aminoacylation	NAS	8496617
GO:0006436	Process	Tryptophanyl-tRNA aminoacylation	TAS	1761529
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	22504299
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1761529
GO:0010628	Process	Positive regulation of gene expression	IDA	22504299
GO:0016874	Function	Ligase activity	IEA
GO:0019210	Function	Kinase inhibitor activity	IDA	22504299
GO:0019901	Function	Protein kinase binding	IPI	22504299
GO:0019904	Function	Protein domain specific binding	IPI	22504299
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	22504299
GO:0032991	Component	Protein-containing complex	IMP	22504299
GO:0042803	Function	Protein homodimerization activity	IDA	22504299, 28369220
GO:0045765	Process	Regulation of angiogenesis	IDA	11773625, 11773626
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145

MIM	HGNC	e!Ensembl
191050	12729	ENSG00000140105

Protein

UniProt ID

P23381

Protein name

Tryptophan--tRNA ligase, cytoplasmic (EC 6.1.1.2) (Interferon-induced protein 53) (IFP53) (Tryptophanyl-tRNA synthetase) (TrpRS) (hWRS) [Cleaved into: T1-TrpRS; T2-TrpRS]

Protein function

Catalyzes the attachment of tryptophan to tRNA(Trp) in a two-step reaction: tryptophan is first activated by ATP to form Trp-AMP and then transferred to the acceptor end of the tRNA(Trp). {ECO:0000269|PubMed:1373391, ECO:0000269|PubMed:1761529,

PDB

1O5T , 1R6T , 1R6U , 1ULH , 2AKE , 2AZX , 2DR2 , 2QUH , 2QUI , 2QUJ , 2QUK , 5UJI , 5UJJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00458	WHEP-TRS	12 → 64	WHEP-TRS domain	Domain
PF00579	tRNA-synt_1b	151 → 443	tRNA synthetases class I (W and Y)	Family

Sequence

MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKA
DCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
ERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT
KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR
TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIF
LTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ

Sequence length

471

Interactions

View interactions

	KEGG		Reactome
	Aminoacyl-tRNA biosynthesis		Cytosolic tRNA aminoacylation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Distal Hereditary Motor Neuronopathy	Neuronopathy, distal hereditary motor, type 9, neuronopathy, distal hereditary motor, type 9	N/A	N/A	ClinVar, GenCC
Neuropathy	distal hereditary motor neuropathy	N/A	N/A	GenCC

Show/Hide Text Mining Associations (49)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Associate	37794510
Alzheimer Disease	Associate	29485232
Arrhythmias Cardiac	Associate	12747836
Atrial Fibrillation	Associate	37967346
Breast Neoplasms	Associate	9848077
Carcinoma Pancreatic Ductal	Stimulate	33179081
Carcinoma Squamous Cell	Associate	22546478
Cardiomyopathy Hypertrophic	Associate	23741347
Cerebral Infarction	Associate	39542148
Colorectal Neoplasms	Associate	19383890, 25206290, 37794510
Conduct Disorder	Associate	23741347
COVID 19	Associate	36499104
Diabetes Gestational	Associate	36313769
Diabetic Retinopathy	Associate	38274229
Drug Hypersensitivity	Associate	33318199
Dyskinesias	Associate	22546478
Epidermolysis Bullosa Junctional	Associate	9085255, 9326326
Epidermolysis Bullosa Junctional Non Herlitz Type	Associate	11564184
Epilepsy	Associate	23257655, 27493204
Epilepsy Absence	Associate	19846749
Epstein Barr Virus Infections	Associate	31033497
Granulomatous Disease Chronic	Associate	30260027
Heart Diseases	Associate	12747836
Hypertrophy	Associate	23741347
IgA Deficiency	Associate	19153537
Immunologic Deficiency Syndromes	Associate	9449702
Infections	Associate	35197508, 36499104
Inflammation	Associate	35197508
Intellectual Disability	Associate	29120065
Leukoencephalopathies	Associate	29120065, 31691183
Lymphatic Metastasis	Associate	23026198
Melanoma Cutaneous Malignant	Associate	38247871
Microvascular Angina	Associate	23741347
Mouth Neoplasms	Stimulate	26110569
Multiple Myeloma	Associate	9233573
Neoplasms	Associate	10576667, 11352943, 11564896, 22546478, 25248565, 26110569, 31033497, 33196683, 8863681
Osteopetrosis	Associate	24336069
Osteosarcoma	Associate	33754909
Parkinson Disease Secondary	Associate	29120065
Pre Excitation Syndromes	Associate	23741347
Prostatic Neoplasms Castration Resistant	Associate	35127252
Prostatitis	Inhibit	11238061
Proteinuria	Associate	9233573
Schizophrenia	Associate	26241350
Seizures	Associate	23257655
Squamous Cell Carcinoma of Head and Neck	Associate	26110569, 31315917
Stomach Neoplasms	Associate	31033497
Virus Diseases	Associate	37543814
Wolff Parkinson White Syndrome	Associate	12397075, 17878938

WARS1 (tryptophanyl-tRNA synthetase 1)