Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7443
Gene name Gene Name - the full gene name approved by the HGNC.	VRK serine/threonine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VRK1
Synonyms (NCBI Gene) Gene synonyms aliases	HMNR10, PCH1, PCH1A
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HMNR10, PCH1A
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal live

Show/Hide all(19)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61736727	T>G	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, coding sequence variant, missense variant
rs137853063	C>G,T	Pathogenic	Stop gained, coding sequence variant, missense variant, non coding transcript variant, genic downstream transcript variant
rs147853760	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	3 prime UTR variant, coding sequence variant, synonymous variant, non coding transcript variant
rs371295780	A>G	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs387906830	C>G,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant, non coding transcript variant
rs771364038	G>A,T	Pathogenic, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs772146380	AAAA>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs772263867	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs772731615	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	3 prime UTR variant, non coding transcript variant, coding sequence variant, missense variant
rs773138218	G>A,C	Pathogenic, likely-pathogenic, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs779282547	AAAC>-	Pathogenic	Frameshift variant, 3 prime UTR variant, non coding transcript variant, coding sequence variant
rs780789145	T>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs869312959	G>A	Pathogenic	Splice donor variant, 3 prime UTR variant
rs1172497555	G>T	Uncertain-significance, pathogenic	Intron variant, missense variant, coding sequence variant
rs1223645705	A>T	Pathogenic	Coding sequence variant, 3 prime UTR variant, non coding transcript variant, stop gained
rs1566696845	TCTTGGTA>-	Likely-pathogenic	Splice donor variant, non coding transcript variant, coding sequence variant, intron variant
rs1566713184	C>T	Pathogenic, likely-pathogenic	Non coding transcript variant, coding sequence variant, stop gained, 3 prime UTR variant
rs1595676477	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1595676517	G>T	Uncertain-significance, pathogenic	Missense variant, non coding transcript variant, coding sequence variant

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030361	hsa-miR-24-3p	Microarray	19748357
MIRT497971	hsa-miR-3662	PAR-CLIP	22291592
MIRT497970	hsa-miR-4694-3p	PAR-CLIP	22291592
MIRT497969	hsa-miR-4693-3p	PAR-CLIP	22291592
MIRT497971	hsa-miR-3662	PAR-CLIP	22291592
MIRT497970	hsa-miR-4694-3p	PAR-CLIP	22291592
MIRT497969	hsa-miR-4693-3p	PAR-CLIP	22291592
MIRT1487485	hsa-miR-1224-5p	CLIP-seq
MIRT1487486	hsa-miR-33a	CLIP-seq
MIRT1487487	hsa-miR-33b	CLIP-seq
MIRT1487488	hsa-miR-3609	CLIP-seq
MIRT1487489	hsa-miR-3682-5p	CLIP-seq
MIRT1487490	hsa-miR-3921	CLIP-seq
MIRT1487491	hsa-miR-4251	CLIP-seq
MIRT1487492	hsa-miR-4329	CLIP-seq
MIRT1487493	hsa-miR-4432	CLIP-seq
MIRT1487494	hsa-miR-4653-5p	CLIP-seq
MIRT1487495	hsa-miR-4696	CLIP-seq
MIRT1487496	hsa-miR-4714-5p	CLIP-seq
MIRT1487497	hsa-miR-4751	CLIP-seq
MIRT1487498	hsa-miR-496	CLIP-seq
MIRT1487499	hsa-miR-513a-5p	CLIP-seq
MIRT1487500	hsa-miR-539	CLIP-seq
MIRT1487501	hsa-miR-548ah	CLIP-seq
MIRT1487502	hsa-miR-548n	CLIP-seq
MIRT1487503	hsa-miR-548t	CLIP-seq
MIRT1487490	hsa-miR-3921	CLIP-seq
MIRT1487491	hsa-miR-4251	CLIP-seq
MIRT1487492	hsa-miR-4329	CLIP-seq
MIRT1487493	hsa-miR-4432	CLIP-seq
MIRT1487494	hsa-miR-4653-5p	CLIP-seq
MIRT1487495	hsa-miR-4696	CLIP-seq
MIRT1487496	hsa-miR-4714-5p	CLIP-seq
MIRT1487499	hsa-miR-513a-5p	CLIP-seq
MIRT1487500	hsa-miR-539	CLIP-seq
MIRT2660779	hsa-miR-3121-3p	CLIP-seq
MIRT2660780	hsa-miR-3671	CLIP-seq
MIRT2660781	hsa-miR-4428	CLIP-seq
MIRT1487499	hsa-miR-513a-5p	CLIP-seq
MIRT2660782	hsa-miR-607	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	IDA	22194607
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	21543316
GO:0005515	Function	Protein binding	IPI	15105425, 15378002, 15542844, 18617507, 19103756, 21920476, 22194607, 22621922, 24492002, 25609649, 25923214, 26869104, 27334688, 29340707
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	22194607
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005795	Component	Golgi stack	IDA	19103756
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	22194607
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0007084	Process	Mitotic nuclear envelope reassembly	TAS
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0019901	Function	Protein kinase binding	IDA	22572157
GO:0031493	Function	Nucleosomal histone binding	IPI	22194607
GO:0035175	Function	Histone kinase activity (H3-S10 specific)	IDA	22194607
GO:0043987	Process	Histone H3-S10 phosphorylation	IDA	22194607
GO:0046777	Process	Protein autophosphorylation	IDA	21543316, 22194607
GO:0051301	Process	Cell division	IEA
GO:0072354	Function	Histone kinase activity (H3-T3 specific)	IDA	22194607
GO:0072355	Process	Histone H3-T3 phosphorylation	IDA	22194607
GO:0090166	Process	Golgi disassembly	IDA	19103756
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

MIM	HGNC	e!Ensembl
602168	12718	ENSG00000100749

Protein

UniProt ID

Q99986

Protein name

Serine/threonine-protein kinase VRK1 (EC 2.7.11.1) (Vaccinia-related kinase 1)

Protein function

Serine/threonine kinase involved in the regulation of key cellular processes including the cell cycle, nuclear condensation, transcription regulation, and DNA damage response (PubMed:14645249, PubMed:18617507, PubMed:19103756, PubMed:33076429).

PDB

2KTY , 2KUL , 2LAV , 2RSV , 3OP5 , 5UKF , 5UVF , 6AC9 , 6BP0 , 6BRU , 6BTW , 6BU6 , 6CFM , 6CMM , 6CNX , 6CQH , 6CSW , 6DD4 , 6NPN , 6VXU , 6VZH , 7M10 , 7TAN , 8F8Y , 8V42

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	37 → 324	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in fetal liver, testis and thymus. {ECO:0000269|PubMed:9344656}.

Sequence

MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
EIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

Sequence length

396

Interactions

View interactions

	Reactome
			Nuclear Envelope Breakdown Initiation of Nuclear Envelope (NE) Reformation

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Mental retardation	Profound Mental Retardation, Mental deficiency, Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	21937992
Multiple congenital anomalies	Multiple congenital anomalies	rs1057517732	25356970
Pontoneocerebellar hypoplasia	Pontocerebellar Hypoplasia Type 1, PONTOCEREBELLAR HYPOPLASIA, TYPE 1B, Pontocerebellar hypoplasia type 1, Congenital pontocerebellar hypoplasia	rs63749985, rs113994152, rs113994153, rs113994154, rs113994150, rs137853063, rs267607036, rs267607035, rs886037629, rs147391618, rs141138948, rs672601331, rs387907196, rs672601332, rs397515426 View all (108 more)	24126608, 19646678, 26633545, 26583493, 21937992
Spinal muscular atrophy	Spinal Muscular Atrophy	rs104893922, rs1554066397, rs77804083, rs104893930, rs104893927, rs104893935, rs387906738, rs398123028, rs371707778, rs398123030, rs587780564, rs713993043, rs727505393, rs797044855, rs863223361 View all (22 more)

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	Source
Unknown
Congenital contracture	Congenital contracture		ClinVar
Microcephaly-Complex Motor And Sensory Axonal Neuropathy Syndrome	microcephaly-complex motor and sensory axonal neuropathy syndrome		GenCC
Schizophrenia	Schizophrenia		GWAS
Neuroblastoma	Neuroblastoma	Loss of SNAI2 function reduces self-renewal, 3D invasion as well as metastatic spread in vivo, while strongly sensitizing neuroblastoma cells to RA-induced growth inhibition.	GWAS, CBGDA
Insomnia	Insomnia		GWAS
Renal Carcinoma	Renal Carcinoma		GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	27456229
Alcoholic Neuropathy	Associate	30847374
Amyotrophic Lateral Sclerosis	Associate	26583493, 30847374, 31527692, 31560180, 38017281, 38554151
Breast Neoplasms	Associate	21829721, 24731990, 30180179, 31970831
Carcinogenesis	Associate	27456229, 34071140
Carcinoma Hepatocellular	Associate	28927264, 38157278
Charcot Marie Tooth disease X linked recessive 2	Associate	31167812
Chromosome Deletion	Associate	32917334
Depression Postpartum	Associate	23284067
Distal Hereditary Motor Neuropathy Type II	Associate	30847374, 38554151
Drug Related Side Effects and Adverse Reactions	Associate	30937657
Drug Resistant Epilepsy	Inhibit	27319807
Ectodermal Dysplasia	Stimulate	38157278
Epileptic Encephalopathy Early Infantile 3	Associate	31527692
Fetal Growth Retardation	Associate	23284067
Genetic Diseases Inborn	Associate	32917334
Glioblastoma	Associate	26956052, 36069976
Glioma	Associate	36040810
Hereditary Sensory and Motor Neuropathy	Associate	31560180
Heredodegenerative Disorders Nervous System	Associate	26583493
Hyperplasia	Associate	35410639
Lung Neoplasms	Associate	23591868, 34071140
Lupus Erythematosus Systemic	Associate	31494269
Lymphatic Metastasis	Stimulate	30180179
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa	Associate	36357561
Microcephaly	Associate	24126608, 31527692, 31560180
Motor Neuron Disease	Associate	26583493, 27281532, 31178479, 31527692, 31560180, 34990802, 38554151
Mouth Neoplasms	Associate	36052378
Multiple Myeloma	Associate	27319807
Muscular Atrophy Spinal	Associate	27281532, 30847374, 31527692, 31560180, 32365420, 38554151
Neointima	Stimulate	35410639
Neoplasm Metastasis	Associate	30180179
Neoplasms	Associate	21829721, 23591868, 24731990, 27319807, 27456229, 28790404, 31101118, 36040810, 36052378, 38157278
Neoplasms	Inhibit	31970831, 36069976
Neoplastic Syndromes Hereditary	Associate	31167812, 34990802
Nerve Degeneration	Associate	24524299
Neuroblastoma	Associate	36040810
Neurologic Manifestations	Associate	31527692
Osteosarcoma	Associate	31810390
Perinatal Death	Associate	23284067
Peripheral Nervous System Diseases	Associate	24126608
Pontocerebellar Hypoplasia	Associate	22452838, 27281532, 31527692, 31560180, 38017281
Pontocerebellar Hypoplasia Type 1	Associate	19646678, 23284067
Pre Eclampsia	Associate	33738906
Respiratory System Abnormalities	Associate	36040810
Schizophrenia	Associate	22234486
Sensorimotor neuropathy with ataxia autosomal dominant	Associate	30847374, 32365420
Spinal Muscular Atrophies of Childhood	Associate	19646678, 31560180
Spinal muscular atrophy Jerash type	Associate	32365420
Squamous Cell Carcinoma of Head and Neck	Associate	16547155
Syndrome	Associate	31527692
Vascular System Injuries	Stimulate	35410639

VRK1 (VRK serine/threonine kinase 1)