Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7391
Gene name	Upstream transcription factor 1
Gene symbol	USF1
Synonyms (NCBI Gene)	FCHLFCHL1HYPLIP1MLTFMLTFIUEFbHLHb11
Chromosome	1
Chromosome location	1q23.3
Summary	This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gen

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2073658	C>T	Risk-factor	Intron variant

Show/Hide all (98)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045419	hsa-miR-149-5p	CLASH	23622248
MIRT040599	hsa-miR-92b-3p	CLASH	23622248
MIRT038834	hsa-miR-93-3p	CLASH	23622248
MIRT1477105	hsa-miR-1285	CLIP-seq
MIRT1477106	hsa-miR-3187-5p	CLIP-seq
MIRT1477107	hsa-miR-4731-5p	CLIP-seq
MIRT1477108	hsa-miR-612	CLIP-seq
MIRT1477109	hsa-miR-1252	CLIP-seq
MIRT1477110	hsa-miR-147b	CLIP-seq
MIRT1477111	hsa-miR-210	CLIP-seq
MIRT1477112	hsa-miR-3151	CLIP-seq
MIRT1477113	hsa-miR-338-3p	CLIP-seq
MIRT1477114	hsa-miR-33a	CLIP-seq
MIRT1477115	hsa-miR-33b	CLIP-seq
MIRT1477116	hsa-miR-34a	CLIP-seq
MIRT1477117	hsa-miR-34c-5p	CLIP-seq
MIRT1477118	hsa-miR-4289	CLIP-seq
MIRT1477119	hsa-miR-4457	CLIP-seq
MIRT1477120	hsa-miR-449a	CLIP-seq
MIRT1477121	hsa-miR-449b	CLIP-seq
MIRT1477122	hsa-miR-4530	CLIP-seq
MIRT1477123	hsa-miR-4688	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT1477125	hsa-miR-586	CLIP-seq
MIRT2364009	hsa-miR-1229	CLIP-seq
MIRT2364010	hsa-miR-193a-3p	CLIP-seq
MIRT2364011	hsa-miR-193b	CLIP-seq
MIRT2364012	hsa-miR-198	CLIP-seq
MIRT2364013	hsa-miR-3591-5p	CLIP-seq
MIRT2364014	hsa-miR-3657	CLIP-seq
MIRT2364015	hsa-miR-3926	CLIP-seq
MIRT2364016	hsa-miR-4323	CLIP-seq
MIRT2364017	hsa-miR-4436a	CLIP-seq
MIRT2364018	hsa-miR-4669	CLIP-seq
MIRT2364019	hsa-miR-4700-3p	CLIP-seq
MIRT2364020	hsa-miR-4712-5p	CLIP-seq
MIRT2364021	hsa-miR-548s	CLIP-seq
MIRT2364022	hsa-miR-648	CLIP-seq
MIRT2364023	hsa-miR-770-5p	CLIP-seq
MIRT2364024	hsa-miR-149	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT1477105	hsa-miR-1285	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477110	hsa-miR-147b	CLIP-seq
MIRT2364012	hsa-miR-198	CLIP-seq
MIRT1477111	hsa-miR-210	CLIP-seq
MIRT1477106	hsa-miR-3187-5p	CLIP-seq
MIRT1477113	hsa-miR-338-3p	CLIP-seq
MIRT1477114	hsa-miR-33a	CLIP-seq
MIRT1477115	hsa-miR-33b	CLIP-seq
MIRT2364013	hsa-miR-3591-5p	CLIP-seq
MIRT2657744	hsa-miR-3622a-3p	CLIP-seq
MIRT2657745	hsa-miR-3622b-3p	CLIP-seq
MIRT2364014	hsa-miR-3657	CLIP-seq
MIRT1477118	hsa-miR-4289	CLIP-seq
MIRT2364016	hsa-miR-4323	CLIP-seq
MIRT2364017	hsa-miR-4436a	CLIP-seq
MIRT1477122	hsa-miR-4530	CLIP-seq
MIRT2364018	hsa-miR-4669	CLIP-seq
MIRT2364019	hsa-miR-4700-3p	CLIP-seq
MIRT2364020	hsa-miR-4712-5p	CLIP-seq
MIRT1477107	hsa-miR-4731-5p	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT2657746	hsa-miR-545	CLIP-seq
MIRT1477125	hsa-miR-586	CLIP-seq
MIRT1477108	hsa-miR-612	CLIP-seq
MIRT2364022	hsa-miR-648	CLIP-seq
MIRT2364023	hsa-miR-770-5p	CLIP-seq
MIRT1477105	hsa-miR-1285	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477110	hsa-miR-147b	CLIP-seq
MIRT2364012	hsa-miR-198	CLIP-seq
MIRT1477111	hsa-miR-210	CLIP-seq
MIRT1477106	hsa-miR-3187-5p	CLIP-seq
MIRT1477113	hsa-miR-338-3p	CLIP-seq
MIRT1477114	hsa-miR-33a	CLIP-seq
MIRT1477115	hsa-miR-33b	CLIP-seq
MIRT2364013	hsa-miR-3591-5p	CLIP-seq
MIRT2657744	hsa-miR-3622a-3p	CLIP-seq
MIRT2657745	hsa-miR-3622b-3p	CLIP-seq
MIRT2364014	hsa-miR-3657	CLIP-seq
MIRT1477118	hsa-miR-4289	CLIP-seq
MIRT2364016	hsa-miR-4323	CLIP-seq
MIRT2364017	hsa-miR-4436a	CLIP-seq
MIRT1477122	hsa-miR-4530	CLIP-seq
MIRT2364018	hsa-miR-4669	CLIP-seq
MIRT2364019	hsa-miR-4700-3p	CLIP-seq
MIRT2364020	hsa-miR-4712-5p	CLIP-seq
MIRT1477107	hsa-miR-4731-5p	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT2657746	hsa-miR-545	CLIP-seq
MIRT1477125	hsa-miR-586	CLIP-seq
MIRT1477108	hsa-miR-612	CLIP-seq
MIRT2364022	hsa-miR-648	CLIP-seq
MIRT2364023	hsa-miR-770-5p	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000430	Process	Regulation of transcription from RNA polymerase II promoter by glucose	IC	8576131
GO:0000430	Process	Regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	ISS
GO:0000785	Component	Chromatin	IDA	27141965
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	2249772
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	8576131, 18234320
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	7852331
GO:0001666	Process	Response to hypoxia	IMP	12917334
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	19303849, 25416956, 27141965, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	2249772, 8576131, 15358760, 18234320
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	19303849
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	2249772
GO:0009411	Process	Response to UV	IEA
GO:0009411	Process	Response to UV	ISS
GO:0010255	Process	Glucose mediated signaling pathway	IEA
GO:0010255	Process	Glucose mediated signaling pathway	IMP	7852331
GO:0019086	Process	Late viral transcription	IDA	2249772
GO:0019899	Function	Enzyme binding	IPI	19303849
GO:0019901	Function	Protein kinase binding	IPI	19303849
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0042593	Process	Glucose homeostasis	TAS	15054483
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IPI	8576131
GO:0042826	Function	Histone deacetylase binding	IPI	19303849
GO:0043425	Function	BHLH transcription factor binding	IPI	8576131
GO:0043565	Function	Sequence-specific DNA binding	IDA	2249772, 8576131
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	27141965
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	7852331, 8576131, 18234320
GO:0045990	Process	Carbon catabolite regulation of transcription	TAS	19303849
GO:0046982	Function	Protein heterodimerization activity	IPI	8576131
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051918	Process	Negative regulation of fibrinolysis	IC	18234320
GO:0055088	Process	Lipid homeostasis	IEA
GO:0055088	Process	Lipid homeostasis	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IMP	7852331
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
191523	12593	ENSG00000158773

P22415

Protein name

Upstream stimulatory factor 1 (Class B basic helix-loop-helix protein 11) (bHLHb11) (Major late transcription factor 1)

Protein function

Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters.

PDB

1AN4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	200 → 255	Helix-loop-helix DNA-binding domain	Domain

Sequence

MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP
RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN

Sequence length

310

Interactions

View interactions

	Reactome
			Estrogen-dependent gene expression

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Hyperlipidemia, familial combined, susceptibility to	risk factor	rs3737787, rs2073658	RCV000013088 RCV000013089

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	22390463
Atherosclerosis	Associate	18276913, 19910639, 24722012, 26068452
Azoospermia	Associate	25374392
Brain Diseases	Associate	22390463
Breast Neoplasms	Associate	35414770
Carcinoma Hepatocellular	Associate	25149140, 25480412
Carcinoma Renal Cell	Associate	39993614
Cardiovascular Diseases	Associate	16699592, 18974842, 24722012
Complement Component C1s Deficiency	Associate	31537905
Congenital myasthenic syndrome ib	Associate	12393509
Coronary Artery Disease	Associate	18276913, 19910639, 26068452
Coronary Disease	Associate	18276913, 18577828, 18974842, 31725952
Death Sudden Cardiac	Associate	18276913
Diabetes Mellitus Type 2	Associate	18445538
Diffuse Neurofibrillary Tangles with Calcification	Inhibit	22390463
Disease	Associate	22390463
Down Syndrome	Associate	11415440
Dyslipidemias	Associate	18303204, 19910639
Gastro enteropancreatic neuroendocrine tumor	Associate	30420588
Gastrointestinal Neoplasms	Associate	12377807
Glioblastoma	Associate	35287174
Glioma	Associate	32776110, 35287174
Hepatitis C	Associate	31337730
Hyperlipidemia Familial Combined	Associate	16699592, 16936202, 17065663, 18230803, 18276913, 18303204, 18445538, 18577828, 19750004, 31725952
Hypertension	Associate	18067551
Infertility Male	Associate	25374392
Kidney Failure Chronic	Associate	16572591
Leukemia Myeloid Acute	Associate	31537905
Liver Cirrhosis	Associate	25149140
Melanoma	Associate	27649659
Metabolic Diseases	Associate	18230803, 18303204
Metabolic Syndrome	Associate	20054229
Nasopharyngeal Carcinoma	Associate	25277193
Neoplasms	Inhibit	12857727, 40102295
Neoplasms	Associate	27589566, 31537905, 35287174
Nephrotic Syndrome	Associate	16572591
Neural Tube Defects	Associate	16126374
Obesity	Associate	18303204
Obesity Abdominal	Associate	18067551
Odontogenic Cyst Calcifying	Associate	18276913
Osteosarcoma	Associate	16126374, 32269179
Plaque Amyloid	Associate	22390463
Plaque Atherosclerotic	Associate	18276913, 24722012
Prostatic Neoplasms	Associate	24175814, 34533293, 39385481
Stomach Neoplasms	Associate	31468594, 40102295
Thyroid Neoplasms	Associate	19730683

USF1 (upstream transcription factor 1)