Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7365
Gene name	UDP glucuronosyltransferase family 2 member B10
Gene symbol	UGT2B10
Synonyms (NCBI Gene)	UDPGT2B10
Chromosome	4
Chromosome location	4q13.2

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61750900	G>A,T	Drug-response	Intron variant, missense variant, coding sequence variant

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT551989	hsa-miR-890	PAR-CLIP	21572407
MIRT551988	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT551987	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT551986	hsa-miR-5690	PAR-CLIP	21572407
MIRT551985	hsa-miR-6804-3p	PAR-CLIP	21572407
MIRT551984	hsa-miR-4281	PAR-CLIP	21572407
MIRT551982	hsa-miR-7977	PAR-CLIP	21572407
MIRT551983	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT551981	hsa-miR-133a-3p	PAR-CLIP	21572407
MIRT735965	hsa-miR-485-5p	Luciferase reporter assayqRT-PCR	31554697
MIRT551989	hsa-miR-890	PAR-CLIP	21572407
MIRT551988	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT551987	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT551986	hsa-miR-5690	PAR-CLIP	21572407
MIRT551985	hsa-miR-6804-3p	PAR-CLIP	21572407
MIRT551984	hsa-miR-4281	PAR-CLIP	21572407
MIRT551982	hsa-miR-7977	PAR-CLIP	21572407
MIRT551983	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT551981	hsa-miR-133a-3p	PAR-CLIP	21572407
MIRT1473622	hsa-miR-216b	CLIP-seq
MIRT1473623	hsa-miR-3921	CLIP-seq
MIRT1473624	hsa-miR-4255	CLIP-seq
MIRT1473625	hsa-miR-4446-5p	CLIP-seq
MIRT1473626	hsa-miR-4653-5p	CLIP-seq
MIRT1473627	hsa-miR-4755-5p	CLIP-seq
MIRT1473628	hsa-miR-4766-5p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	TAS	8333863
GO:0008194	Function	UDP-glycosyltransferase activity	IBA
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008210	Process	Estrogen metabolic process	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	8333863
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
600070	12544	ENSG00000109181

P36537

Protein name

UDP-glucuronosyltransferase 2B10 (UDPGT 2B10) (EC 2.4.1.17)

Protein function

UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

PDB

7YF5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	23 → 525	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Sequence

MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSAS
ILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAIND
IIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFE
RHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLG
RPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGE
NGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQND
LLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMS
STDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAH
NLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD

Sequence length

528

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Bantu siderosis	Associate	25233931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	29438977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	36199423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Associate	31790828	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	23110092	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Stimulate	23110092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Associate	29631575	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	28586067	★★★★★ ★☆☆☆☆ Found in Text Mining only

UGT2B10 (UDP glucuronosyltransferase family 2 member B10)