Gene Gene information from NCBI Gene database.
Entrez ID 7357
Gene name UDP-glucose ceramide glucosyltransferase
Gene symbol UGCG
Synonyms (NCBI Gene)
GCSGLCT1
Chromosome 9
Chromosome location 9q31.3
Summary This gene encodes an enzyme that catalyzes the first glycosylation step in the biosynthesis of glycosphingolipids, which are membrane components containing lipid and sugar moieties. The product of this reaction is glucosylceramide, which is the core struc
miRNA miRNA information provided by mirtarbase database.
393
miRTarBase ID miRNA Experiments Reference
MIRT019137 hsa-miR-335-5p Microarray 18185580
MIRT020053 hsa-miR-375 Microarray 20215506
MIRT464472 hsa-miR-27a-3p HITS-CLIP 23824327
MIRT464471 hsa-miR-27b-3p HITS-CLIP 23824327
MIRT612317 hsa-miR-5683 HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SP1 Activation 15342415
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 12873973
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 12873973
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602874 12524 ENSG00000148154
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16739
Protein name Ceramide glucosyltransferase (EC 2.4.1.80) (GLCT-1) (Glucosylceramide synthase) (GCS) (Glycosylceramide synthase) (UDP-glucose ceramide glucosyltransferase) (UDP-glucose:N-acylsphingosine D-glucosyltransferase)
Protein function Participates in the initial step of the glucosylceramide-based glycosphingolipid/GSL synthetic pathway at the cytosolic surface of the Golgi (PubMed:1532799, PubMed:8643456). Catalyzes the transfer of glucose from UDP-glucose to ceramide to prod
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13506 Glyco_transf_21 106 278 Glycosyl transferase family 21 Domain
Tissue specificity TISSUE SPECIFICITY: Found in all tissues examined. {ECO:0000269|PubMed:8643456}.
Sequence
MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTK
LRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
Sequence length 394
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Sphingolipid metabolism
Metabolic pathways
  Glycosphingolipid metabolism
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital nonbullous ichthyosiform erythroderma Conflicting classifications of pathogenicity rs2118539976 RCV001844313
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26001295
Aneurysm Ruptured Stimulate 40500739
Breast Neoplasms Associate 14967819, 18560890, 19502811, 23133636, 24456584, 25655580, 27191984, 29549423, 31666638, 32424263, 33080569, 40332226, 9873062
Breast Neoplasms Stimulate 21617856
Calcinosis Cutis Associate 21617856
Carcinoma Ductal Inhibit 24456584
Carcinoma Hepatocellular Associate 39796160
Carcinoma Intraductal Noninfiltrating Stimulate 24456584
Cardiomegaly Associate 37658291
Colorectal Neoplasms Associate 22424291, 25535133, 31972222