Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7272
Gene name Gene Name - the full gene name approved by the HGNC.	TTK protein kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TTK
Synonyms (NCBI Gene) Gene synonyms aliases	CT96, ESK, MPH1, MPS1, MPS1L1, PYT
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a dual specificity protein kinase with the ability to phosphorylate tyrosine, serine and threonine. Associated with cell proliferation, this protein is essential for chromosome alignment at the centromere during mitosis and is required f

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520011	G>T	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001746	hsa-miR-376a-5p	Luciferase reporter assay	17322061
MIRT001746	hsa-miR-376a-5p	Luciferase reporter assay	17322061
MIRT019665	hsa-miR-376a-3p	Reporter assay	17322061
MIRT024895	hsa-miR-215-5p	Microarray	19074876
MIRT026393	hsa-miR-192-5p	Microarray	19074876
MIRT438190	hsa-miR-524-5p	Luciferase reporter assay	24194606
MIRT438190	hsa-miR-524-5p	Luciferase reporter assay	24194606
MIRT438190	hsa-miR-524-5p	Luciferase reporter assay	24194606
MIRT438190	hsa-miR-524-5p	Luciferase reporter assay	24194606
MIRT169515	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT169516	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT1462125	hsa-miR-105	CLIP-seq
MIRT1462126	hsa-miR-1273g	CLIP-seq
MIRT1462127	hsa-miR-1283	CLIP-seq
MIRT1462128	hsa-miR-129-5p	CLIP-seq
MIRT1462129	hsa-miR-1297	CLIP-seq
MIRT1462130	hsa-miR-132	CLIP-seq
MIRT1462131	hsa-miR-1323	CLIP-seq
MIRT1462132	hsa-miR-140-5p	CLIP-seq
MIRT1462133	hsa-miR-212	CLIP-seq
MIRT1462134	hsa-miR-26a	CLIP-seq
MIRT1462135	hsa-miR-26b	CLIP-seq
MIRT1462136	hsa-miR-2964a-5p	CLIP-seq
MIRT1462137	hsa-miR-323b-3p	CLIP-seq
MIRT1462138	hsa-miR-335	CLIP-seq
MIRT1462139	hsa-miR-338-5p	CLIP-seq
MIRT1462140	hsa-miR-3618	CLIP-seq
MIRT1462141	hsa-miR-3662	CLIP-seq
MIRT1462142	hsa-miR-3668	CLIP-seq
MIRT1462143	hsa-miR-3671	CLIP-seq
MIRT1462144	hsa-miR-3692	CLIP-seq
MIRT1462145	hsa-miR-3919	CLIP-seq
MIRT1462146	hsa-miR-3935	CLIP-seq
MIRT1462147	hsa-miR-3941	CLIP-seq
MIRT1462148	hsa-miR-4301	CLIP-seq
MIRT1462149	hsa-miR-4328	CLIP-seq
MIRT1462150	hsa-miR-4465	CLIP-seq
MIRT1462151	hsa-miR-455-3p	CLIP-seq
MIRT1462152	hsa-miR-466	CLIP-seq
MIRT1462153	hsa-miR-4662a-5p	CLIP-seq
MIRT1462154	hsa-miR-4672	CLIP-seq
MIRT1462155	hsa-miR-4680-3p	CLIP-seq
MIRT1462156	hsa-miR-4724-5p	CLIP-seq
MIRT1462157	hsa-miR-4731-3p	CLIP-seq
MIRT1462158	hsa-miR-4801	CLIP-seq
MIRT1462159	hsa-miR-511	CLIP-seq
MIRT1462160	hsa-miR-548o	CLIP-seq
MIRT1462161	hsa-miR-570	CLIP-seq
MIRT1462162	hsa-miR-582-5p	CLIP-seq
MIRT1462163	hsa-miR-607	CLIP-seq
MIRT1462164	hsa-miR-616	CLIP-seq
MIRT1462165	hsa-miR-628-5p	CLIP-seq
MIRT2138881	hsa-miR-4699-3p	CLIP-seq
MIRT2138882	hsa-miR-520d-5p	CLIP-seq
MIRT2138883	hsa-miR-561	CLIP-seq
MIRT1462162	hsa-miR-582-5p	CLIP-seq
MIRT1462125	hsa-miR-105	CLIP-seq
MIRT1462128	hsa-miR-129-5p	CLIP-seq
MIRT1462129	hsa-miR-1297	CLIP-seq
MIRT1462130	hsa-miR-132	CLIP-seq
MIRT1462131	hsa-miR-1323	CLIP-seq
MIRT1462133	hsa-miR-212	CLIP-seq
MIRT1462134	hsa-miR-26a	CLIP-seq
MIRT1462135	hsa-miR-26b	CLIP-seq
MIRT1462136	hsa-miR-2964a-5p	CLIP-seq
MIRT1462138	hsa-miR-335	CLIP-seq
MIRT1462141	hsa-miR-3662	CLIP-seq
MIRT1462142	hsa-miR-3668	CLIP-seq
MIRT1462143	hsa-miR-3671	CLIP-seq
MIRT1462144	hsa-miR-3692	CLIP-seq
MIRT1462146	hsa-miR-3935	CLIP-seq
MIRT1462150	hsa-miR-4465	CLIP-seq
MIRT1462151	hsa-miR-455-3p	CLIP-seq
MIRT1462153	hsa-miR-4662a-5p	CLIP-seq
MIRT2138881	hsa-miR-4699-3p	CLIP-seq
MIRT1462159	hsa-miR-511	CLIP-seq
MIRT1462160	hsa-miR-548o	CLIP-seq
MIRT1462163	hsa-miR-607	CLIP-seq
MIRT1462164	hsa-miR-616	CLIP-seq
MIRT1462165	hsa-miR-628-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
E2F4	Repression	17981789

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	19273613
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005819	Component	Spindle	IBA	21873635
GO:0007051	Process	Spindle organization	TAS	10366450
GO:0007052	Process	Mitotic spindle organization	TAS	7737118
GO:0007059	Process	Chromosome segregation	IBA	21873635
GO:0007094	Process	Mitotic spindle assembly checkpoint	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1639825
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	TAS	19018011
GO:0016020	Component	Membrane	HDA	19946888
GO:0016321	Process	Female meiosis chromosome segregation	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0018107	Process	Peptidyl-threonine phosphorylation	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0033316	Process	Meiotic spindle assembly checkpoint	IBA	21873635
GO:0034501	Process	Protein localization to kinetochore	IBA	21873635
GO:0043515	Function	Kinetochore binding	IEA
GO:0046777	Process	Protein autophosphorylation	IEA
GO:0051304	Process	Chromosome separation	IEA
GO:1903096	Process	Protein localization to meiotic spindle midzone	IEA

MIM	HGNC	e!Ensembl
604092	12401	ENSG00000112742

Protein

UniProt ID

P33981

Protein name

Dual specificity protein kinase TTK (EC 2.7.12.1) (Phosphotyrosine picked threonine-protein kinase) (PYT)

Protein function

Involved in mitotic spindle assembly checkpoint signaling, a process that delays anaphase until chromosomes are bioriented on the spindle, and in the repair of incorrect mitotic kinetochore-spindle microtubule attachments (PubMed:18243099, PubMe

PDB

2X9E , 2ZMC , 2ZMD , 3CEK , 3DBQ , 3GFW , 3H9F , 3HMN , 3HMO , 3HMP , 3VQU , 3W1F , 3WYX , 3WYY , 3WZJ , 3WZK , 4B94 , 4BHZ , 4BI0 , 4BI1 , 4BI2 , 4C4E , 4C4F , 4C4G , 4C4H , 4C4I , 4C4J , 4CV8 , 4CV9 , 4CVA , 4D2S , 4H7X , 4H7Y , 4JS8 , 4JT3 , 4O6L , 4ZEG , 5AP0 , 5AP1 , 5AP2 , 5AP3 , 5AP4 , 5AP5 , 5AP6 , 5AP7 , 5EH0 , 5EHL , 5EHO , 5EHY , 5EI2 , 5EI6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	525 → 791	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Present in rapidly proliferating cell lines.

Sequence

MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK

Sequence length

857

Interactions

View interactions

	KEGG
	Cell cycle

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.		GWAS, CBGDA

Show/Hide Text Mining Associations (57)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	23874428, 32121037, 32149105, 33148251, 33187219, 36451444, 36906970
Aneuploidy	Associate	23700430, 28415765, 36430712
Aneuploidy	Inhibit	28380042
Arthritis Rheumatoid	Associate	33407587
Breast Neoplasms	Associate	19274768, 24462521, 29925769, 31083605, 31280346, 31961339, 35447458, 36726984, 39354417
Carcinogenesis	Associate	26418879, 29721084, 32462022, 34876569
Carcinoma Hepatocellular	Associate	24905462, 25141867, 26418879, 28299790, 29925769, 30702595, 34130591, 34187556, 34257549, 35322101, 35493518, 37059592
Carcinoma Non Small Cell Lung	Associate	29721084, 31746439, 32969465
Carcinoma Pancreatic Ductal	Stimulate	25137017
Carcinoma Pancreatic Ductal	Associate	28380042
Carcinoma Renal Cell	Associate	26804907
Carcinoma Transitional Cell	Associate	34456216
Chromosomal Instability	Associate	18545697, 28415765, 32557940
Colonic Neoplasms	Associate	37770979
Colorectal Neoplasms	Associate	27383047, 27635108, 29925769, 32888483, 37770979, 37894942
Drug Related Side Effects and Adverse Reactions	Associate	34876569
Endometrial Neoplasms	Associate	33282948, 33627787, 36232772, 36829176
Esophageal Squamous Cell Carcinoma	Associate	18452554, 22499122, 31485619
Gallbladder Neoplasms	Associate	28883705
Glioblastoma	Associate	25991676
Glioma	Associate	22022424
Hepatitis B	Associate	33102593
Hypoxia	Associate	33148251
Infections	Associate	28777004
Kidney Neoplasms	Associate	36849137
Leukemia Myeloid Acute	Associate	32557940
Lung Diseases	Associate	28777004
Lung Neoplasms	Associate	17784873, 36150391
Lupus Erythematosus Systemic	Associate	36726984
Medulloblastoma	Associate	27633003
Multiple Myeloma	Associate	31289205
Necrosis	Associate	25137017
Neoplasm Invasiveness	Associate	32228488
Neoplasm Metastasis	Inhibit	28883705
Neoplasms	Associate	1639825, 17784873, 19274768, 20861309, 22499122, 24074379, 24462521, 25141867, 25991676, 26364596, 26637805, 26804907, 27383047, 27633003, 27635108 View all (21 more)
Neoplasms	Stimulate	26418879, 33282948
Neoplasms	Inhibit	32530571
Neoplasms Cystic Mucinous and Serous	Associate	36829176
Non Muscle Invasive Bladder Neoplasms	Stimulate	34456216
Osteosarcoma	Associate	33176597
Ovarian Neoplasms	Associate	31010415, 34072728, 34516342, 34598710, 34876569, 36849137, 37304238
Pancreatic Neoplasms	Associate	20581473, 25137017, 28380042
Prostatic Neoplasms	Stimulate	21917134
Prostatic Neoplasms	Associate	22509301, 32243390, 34497666, 37682152
Retinoblastoma	Associate	33217867
Squamous Cell Carcinoma of Head and Neck	Associate	32228488
Stomach Neoplasms	Associate	32530571
Tachycardia Atrioventricular Nodal Reentry	Inhibit	28883705
Thrombosis	Stimulate	26418879
Thyroid Cancer Papillary	Associate	37815894
Thyroid Neoplasms	Associate	37815894
Thyroiditis	Associate	37815894
Triple Negative Breast Neoplasms	Stimulate	23700430
Triple Negative Breast Neoplasms	Associate	27833085, 29378962
Urinary Bladder Neoplasms	Stimulate	33217824
Urinary Bladder Neoplasms	Associate	34456216, 36181054
Uterine Cervical Neoplasms	Associate	33829064, 37272088

TTK (TTK protein kinase)