Gene Gene information from NCBI Gene database.
Entrez ID 7262
Gene name Pleckstrin homology like domain family A member 2
Gene symbol PHLDA2
Synonyms (NCBI Gene)
BRW1CBWR1CHLDA2IPLTSSC3
Chromosome 11
Chromosome location 11p15.4
Summary This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarco
miRNA miRNA information provided by mirtarbase database.
100
miRTarBase ID miRNA Experiments Reference
MIRT016330 hsa-miR-193b-3p Microarray 20304954
MIRT028418 hsa-miR-30a-5p Proteomics 18668040
MIRT029073 hsa-miR-26b-5p Microarray 19088304
MIRT031541 hsa-miR-16-5p Proteomics 18668040
MIRT700821 hsa-miR-6819-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0001890 Process Placenta development IBA
GO:0001890 Process Placenta development IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0006915 Process Apoptotic process TAS 9328465
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602131 12385 ENSG00000181649
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q53GA4
Protein name Pleckstrin homology-like domain family A member 2 (Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein) (Imprinted in placenta and liver protein) (Tumor-suppressing STF cDNA 3 protein) (Tumor-suppressing subchromosomal transferable f
Protein function Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal
Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDC
VERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPA
APAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Sequence length 152
Interactions View interactions