Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7262
Gene name Gene Name - the full gene name approved by the HGNC.
Pleckstrin homology like domain family A member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PHLDA2
Synonyms (NCBI Gene) Gene synonyms aliases
BRW1C, BWR1C, HLDA2, IPL, TSSC3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarco
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016330 hsa-miR-193b-3p Microarray 20304954
MIRT028418 hsa-miR-30a-5p Proteomics 18668040
MIRT029073 hsa-miR-26b-5p Microarray 19088304
MIRT031541 hsa-miR-16-5p Proteomics 18668040
MIRT700821 hsa-miR-6819-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001890 Process Placenta development IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0006915 Process Apoptotic process TAS 9328465
GO:0009887 Process Animal organ morphogenesis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602131 12385 ENSG00000181649
Protein
UniProt ID Q53GA4
Protein name Pleckstrin homology-like domain family A member 2 (Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein) (Imprinted in placenta and liver protein) (Tumor-suppressing STF cDNA 3 protein) (Tumor-suppressing subchromosomal transferable f
Protein function Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal
Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDC
VERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPA
APAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Sequence length 152
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)
15496427
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 27929073
Abortion Spontaneous Associate 20484977
Breast Neoplasms Associate 39300389
Carcinogenesis Inhibit 30092789
Carcinogenesis Associate 32385195
Carcinoma Hepatocellular Associate 37474643
Carcinoma Pancreatic Ductal Associate 29660218
Colorectal Neoplasms Stimulate 32385195
Diabetes Gestational Stimulate 31194812
Diabetic Nephropathies Associate 37986381