Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7259
Gene name Gene Name - the full gene name approved by the HGNC.
TSPY like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSPYL1
Synonyms (NCBI Gene) Gene synonyms aliases
TSPYL
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is found in the nucleolus and is similar to that of a family of genes on the Y-chromosome. This gene is intronless. Defects in this gene are a cause of sudden infant death with dysgenesis of the testes syndrome (SIDDT). [p
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004190 hsa-miR-197-3p Microarray 16822819
MIRT040692 hsa-miR-92b-3p CLASH 23622248
MIRT036870 hsa-miR-877-3p CLASH 23622248
MIRT036165 hsa-miR-320c CLASH 23622248
MIRT052748 hsa-miR-1260b CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA 21873635
GO:0003682 Function Chromatin binding IBA 21873635
GO:0005634 Component Nucleus IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604714 12382 ENSG00000189241
Protein
UniProt ID Q9H0U9
Protein name Testis-specific Y-encoded-like protein 1 (TSPY-like protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00956 NAP 272 411 Nucleosome assembly protein (NAP) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis, ovary, liver, spleen, brain, kidney, prostate, lung, liver, and heart. {ECO:0000269|PubMed:9730615}.
Sequence
MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALP
PPPPSEEGGVPQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRS
LKKGVQGGEKALEICGAQRSASELTAGAEAEAEEVKTGKCATVSAAVAERESAEVVKEGL
AEKEVMEEQMEVEEQPPEGEEIEVAEEDRLEEEAREEEGPWPLHEALRMDPLEAIQLELD
TVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGQDAEM
LRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRRG
HEPQSFIRRNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLLR
EGVRRARRR
PLREPVEIPRPFGFQSG
Sequence length 437
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086
View all (27 more)
Unknown
Disease term Disease name Evidence References Source
Ambiguous genitalia Ambiguous Genitalia ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Azoospermia Associate 19463995, 22137496
Blindness Associate 19463995
Conversion Disorder Associate 19463995
Death Sudden Associate 15273283
Disorder of Sex Development 46 XY Associate 19463995
Gonadal Dysgenesis Associate 19463995
Infertility Male Associate 19463995
Oligospermia Associate 22137496
Prostatic Neoplasms Castration Resistant Associate 29027195
Sudden Infant Death with Dysgenesis of the Testes Syndrome Associate 15273283, 16418600