Gene Gene information from NCBI Gene database.
Entrez ID 7184
Gene name Heat shock protein 90 beta family member 1
Gene symbol HSP90B1
Synonyms (NCBI Gene)
ECGPGP96GRP94HEL-S-125mHEL35TRA1
Chromosome 12
Chromosome location 12q23.3
Summary This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this
miRNA miRNA information provided by mirtarbase database.
331
miRTarBase ID miRNA Experiments Reference
MIRT003874 hsa-miR-15a-5p Microarray 18362358
MIRT004368 hsa-miR-16-5p Microarray 18362358
MIRT004158 hsa-miR-192-5p Microarray 16822819
MIRT007086 hsa-miR-223-3p Luciferase reporter assay 23208072
MIRT007086 hsa-miR-223-3p Luciferase reporter assay 23208072
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
62
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001666 Process Response to hypoxia IDA 15620698
GO:0003723 Function RNA binding IDA 11958450
GO:0004864 Function Protein phosphatase inhibitor activity IDA 19000834
GO:0005509 Function Calcium ion binding TAS 10497210
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
191175 12028 ENSG00000166598
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P14625
Protein name Endoplasmin (EC 3.6.4.-) (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Heat shock protein family C member 4) (Tumor rejection antigen 1) (gp96 homolog)
Protein function ATP-dependent chaperone involved in the processing of proteins in the endoplasmic reticulum, regulating their transport (PubMed:23572575, PubMed:39509507). Together with MESD, acts as a modulator of the Wnt pathway by promoting the folding of LR
PDB 4NH9 , 7ULL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02518 HATPase_c 96 255 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Domain
PF00183 HSP90 257 781 Hsp90 protein Family
Sequence
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEA
SDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDE
E
MDVGTDEEEETAKESTAEKDEL
Sequence length 803
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
IL-17 signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Salmonella infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Prostate cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  Trafficking and processing of endosomal TLR
Scavenging by Class A Receptors
ATF6 (ATF6-alpha) activates chaperone genes
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Interleukin-4 and Interleukin-13 signaling
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs11547724 RCV005904559
Clear cell carcinoma of kidney Benign rs11547724 RCV005904560
Colon adenocarcinoma Benign rs11547724 RCV005904558
Gastric cancer Benign rs11547724 RCV005904562
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acquired ichthyosis Associate 36303457
Adenocarcinoma Stimulate 31970893
Adenocarcinoma Of Esophagus Associate 18331622
Adenocarcinoma of Lung Associate 31970893, 36291587
Adenoma Associate 26066753
Adrenocortical Carcinoma Associate 36291587
Autoimmune Diseases Associate 24816397, 33542414
Axial osteomalacia Associate 34698138
Bipolar Disorder Associate 18771604
Breast Neoplasms Associate 22363530, 33145341