Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7182
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 2 group C member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NR2C2
Synonyms (NCBI Gene) Gene synonyms aliases
TAK1, TR4
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030801 hsa-miR-21-5p Microarray 18591254
MIRT039640 hsa-miR-615-3p CLASH 23622248
MIRT054554 hsa-miR-26b-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 24565101
MIRT054554 hsa-miR-26b-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 24565101
MIRT437449 hsa-miR-143-3p Luciferase reporter assay, qRT-PCR, Western blot 24105952
Transcription factors
Transcription factor Regulation Reference
DR1 Unknown 21126370
ELK4 Unknown 21126370
STAT3 Unknown 15764709
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IPI 17974920
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9556573
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10644740
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601426 7972 ENSG00000177463
Protein
UniProt ID P49116
Protein name Nuclear receptor subfamily 2 group C member 2 (Orphan nuclear receptor TAK1) (Orphan nuclear receptor TR4) (Testicular receptor 4)
Protein function Orphan nuclear receptor that can act as a repressor or activator of transcription. An important repressor of nuclear receptor signaling pathways such as retinoic acid receptor, retinoid X, vitamin D3 receptor, thyroid hormone receptor and estrog
PDB 3P0U , 7XV6 , 7XV8 , 7XV9 , 7XVA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 115 184 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 371 567 Ligand-binding domain of nuclear hormone receptor Domain
Sequence
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKM
ESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQ
PEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGASL
Sequence length 596
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Receptor transcription pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 22138541 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenoma Associate 28986304
Alternating hemiplegia of childhood Associate 31633027
Breast Neoplasms Associate 11844790
Carcinoma Non Small Cell Lung Associate 26144287
Cardiovascular Diseases Associate 25623427
Colorectal Neoplasms Associate 30809968
Diabetes Mellitus Associate 36651297
Diabetes Mellitus Type 2 Associate 22086326
Glycogen Storage Disease Type II Associate 23940728
Hallucinations Associate 30367354