Gene Gene information from NCBI Gene database.
Entrez ID 7181
Gene name Nuclear receptor subfamily 2 group C member 1
Gene symbol NR2C1
Synonyms (NCBI Gene)
TR2
Chromosome 12
Chromosome location 12q22
Summary This gene encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1592778920 C>G Likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
180
miRTarBase ID miRNA Experiments Reference
MIRT440096 hsa-miR-142-3p HITS-CLIP 22473208
MIRT440096 hsa-miR-142-3p HITS-CLIP 22473208
MIRT1192184 hsa-miR-106a CLIP-seq
MIRT1192185 hsa-miR-106b CLIP-seq
MIRT1192186 hsa-miR-1200 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IPI 17974920
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601529 7971 ENSG00000120798
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13056
Protein name Nuclear receptor subfamily 2 group C member 1 (Orphan nuclear receptor TR2) (Testicular receptor 2)
Protein function Orphan nuclear receptor. Binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. Primarily repressor of a broad range of genes. Binds to hormone response elements (HREs) consisting of two 5'-AGGTCA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 111 180 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 378 574 Ligand-binding domain of nuclear hormone receptor Domain
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKA
SGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQ

DSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSGM
FMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLANLGKTKDLSQNSNEMSMIES
LSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSIN
YTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQE
NSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIF
KLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTY
PDDTYRLSRLLLRLPALRLMNATITEELFFKGLI
GNIRIDSVIPHILKMEPADYNSQIIG
HSI
Sequence length 603
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Receptor transcription pathway
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Flexion contracture Likely pathogenic rs1592778920 RCV001007799
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 33941198
Esophageal Neoplasms Associate 21196216
Esophageal Squamous Cell Carcinoma Associate 21196216
Leukemia Myeloid Acute Associate 22183068