TPR (translocated promoter region, nuclear basket protein)

Gene

• Entrez ID: 7175
• Gene name: Translocated promoter region, nuclear basket protein
• Gene symbol: TPR
• Synonyms (NCBI Gene): MRT79
• Chromosome: 1
• Chromosome location: 1q31.1
• Summary: This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRN

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020054	hsa-miR-375	Microarray	20215506
MIRT043991	hsa-miR-378a-5p	CLASH	23622248
MIRT040002	hsa-miR-615-3p	CLASH	23622248
MIRT035929	hsa-miR-1180-3p	CLASH	23622248
MIRT533546	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT533545	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT533544	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT533543	hsa-miR-612	PAR-CLIP	22012620
MIRT533542	hsa-miR-6860	PAR-CLIP	22012620
MIRT533541	hsa-miR-4486	PAR-CLIP	22012620
MIRT533540	hsa-miR-378g	PAR-CLIP	22012620
MIRT533539	hsa-miR-6721-5p	PAR-CLIP	22012620
MIRT533538	hsa-miR-4314	PAR-CLIP	22012620
MIRT533537	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT533536	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT533535	hsa-miR-370-5p	PAR-CLIP	22012620
MIRT533534	hsa-miR-664a-3p	PAR-CLIP	22012620
MIRT533533	hsa-miR-5696	PAR-CLIP	22012620
MIRT533532	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT533531	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT533530	hsa-miR-8081	PAR-CLIP	22012620
MIRT533529	hsa-miR-30a-3p	PAR-CLIP	22012620
MIRT533528	hsa-miR-30d-3p	PAR-CLIP	22012620
MIRT533527	hsa-miR-30e-3p	PAR-CLIP	22012620
MIRT446048	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT446047	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT446045	hsa-miR-4307	PAR-CLIP	22100165
MIRT439398	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439398	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT533529	hsa-miR-30a-3p	PAR-CLIP	27292025
MIRT533529	hsa-miR-30a-3p	PAR-CLIP	27292025
MIRT533528	hsa-miR-30d-3p	PAR-CLIP	27292025
MIRT533528	hsa-miR-30d-3p	PAR-CLIP	27292025
MIRT533527	hsa-miR-30e-3p	PAR-CLIP	27292025
MIRT533527	hsa-miR-30e-3p	PAR-CLIP	27292025
MIRT533546	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT533545	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT533544	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT533543	hsa-miR-612	PAR-CLIP	22012620
MIRT533542	hsa-miR-6860	PAR-CLIP	22012620
MIRT533541	hsa-miR-4486	PAR-CLIP	22012620
MIRT533540	hsa-miR-378g	PAR-CLIP	22012620
MIRT533539	hsa-miR-6721-5p	PAR-CLIP	22012620
MIRT533538	hsa-miR-4314	PAR-CLIP	22012620
MIRT533537	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT533536	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT533535	hsa-miR-370-5p	PAR-CLIP	22012620
MIRT533534	hsa-miR-664a-3p	PAR-CLIP	22012620
MIRT533533	hsa-miR-5696	PAR-CLIP	22012620
MIRT533532	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT533531	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT533530	hsa-miR-8081	PAR-CLIP	22012620
MIRT533529	hsa-miR-30a-3p	PAR-CLIP	22012620
MIRT533528	hsa-miR-30d-3p	PAR-CLIP	22012620
MIRT533527	hsa-miR-30e-3p	PAR-CLIP	22012620
MIRT446048	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT446047	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT446045	hsa-miR-4307	PAR-CLIP	22100165
MIRT1450157	hsa-miR-1236	CLIP-seq
MIRT1450158	hsa-miR-128	CLIP-seq
MIRT1450159	hsa-miR-146a	CLIP-seq
MIRT1450160	hsa-miR-146b-5p	CLIP-seq
MIRT1450161	hsa-miR-183	CLIP-seq
MIRT1450162	hsa-miR-208a	CLIP-seq
MIRT1450163	hsa-miR-208b	CLIP-seq
MIRT1450164	hsa-miR-2467-3p	CLIP-seq
MIRT1450165	hsa-miR-27a	CLIP-seq
MIRT1450166	hsa-miR-27b	CLIP-seq
MIRT1450167	hsa-miR-302f	CLIP-seq
MIRT1450168	hsa-miR-3129-3p	CLIP-seq
MIRT1450169	hsa-miR-3148	CLIP-seq
MIRT1450170	hsa-miR-3156-5p	CLIP-seq
MIRT1450171	hsa-miR-3158-5p	CLIP-seq
MIRT1450172	hsa-miR-3161	CLIP-seq
MIRT1450173	hsa-miR-3190	CLIP-seq
MIRT1450174	hsa-miR-3607-3p	CLIP-seq
MIRT1450175	hsa-miR-3662	CLIP-seq
MIRT1450176	hsa-miR-3678-3p	CLIP-seq
MIRT1450177	hsa-miR-3682-5p	CLIP-seq
MIRT1450178	hsa-miR-3686	CLIP-seq
MIRT1450179	hsa-miR-374a	CLIP-seq
MIRT1450180	hsa-miR-374b	CLIP-seq
MIRT1450181	hsa-miR-383	CLIP-seq
MIRT1450182	hsa-miR-409-3p	CLIP-seq
MIRT1450183	hsa-miR-4275	CLIP-seq
MIRT1450184	hsa-miR-4418	CLIP-seq
MIRT1450185	hsa-miR-4424	CLIP-seq
MIRT1450186	hsa-miR-4432	CLIP-seq
MIRT1450187	hsa-miR-4477a	CLIP-seq
MIRT1450188	hsa-miR-4704-5p	CLIP-seq
MIRT1450189	hsa-miR-4735-5p	CLIP-seq
MIRT1450190	hsa-miR-4753-3p	CLIP-seq
MIRT1450191	hsa-miR-4768-5p	CLIP-seq
MIRT1450192	hsa-miR-4775	CLIP-seq
MIRT1450193	hsa-miR-4780	CLIP-seq
MIRT1450194	hsa-miR-499-5p	CLIP-seq
MIRT1450195	hsa-miR-509-3-5p	CLIP-seq
MIRT1450196	hsa-miR-509-5p	CLIP-seq
MIRT1450197	hsa-miR-513a-5p	CLIP-seq
MIRT1450198	hsa-miR-589	CLIP-seq
MIRT1450199	hsa-miR-656	CLIP-seq
MIRT1450200	hsa-miR-889	CLIP-seq
MIRT1450158	hsa-miR-128	CLIP-seq
MIRT1450165	hsa-miR-27a	CLIP-seq
MIRT1450166	hsa-miR-27b	CLIP-seq
MIRT1450172	hsa-miR-3161	CLIP-seq
MIRT2134566	hsa-miR-3606	CLIP-seq
MIRT1450188	hsa-miR-4704-5p	CLIP-seq
MIRT1450197	hsa-miR-513a-5p	CLIP-seq
MIRT1450157	hsa-miR-1236	CLIP-seq
MIRT1450158	hsa-miR-128	CLIP-seq
MIRT2355871	hsa-miR-203	CLIP-seq
MIRT1450165	hsa-miR-27a	CLIP-seq
MIRT1450166	hsa-miR-27b	CLIP-seq
MIRT1450168	hsa-miR-3129-3p	CLIP-seq
MIRT1450172	hsa-miR-3161	CLIP-seq
MIRT2355872	hsa-miR-410	CLIP-seq
MIRT1450187	hsa-miR-4477a	CLIP-seq
MIRT1450190	hsa-miR-4753-3p	CLIP-seq
MIRT1450191	hsa-miR-4768-5p	CLIP-seq
MIRT2355873	hsa-miR-489	CLIP-seq
MIRT2355874	hsa-miR-496	CLIP-seq
MIRT1450197	hsa-miR-513a-5p	CLIP-seq
MIRT1450157	hsa-miR-1236	CLIP-seq
MIRT1450158	hsa-miR-128	CLIP-seq
MIRT1450165	hsa-miR-27a	CLIP-seq
MIRT1450166	hsa-miR-27b	CLIP-seq
MIRT1450168	hsa-miR-3129-3p	CLIP-seq
MIRT1450190	hsa-miR-4753-3p	CLIP-seq
MIRT1450191	hsa-miR-4768-5p	CLIP-seq
MIRT1450197	hsa-miR-513a-5p	CLIP-seq
MIRT2462232	hsa-miR-1253	CLIP-seq
MIRT2462233	hsa-miR-3136-5p	CLIP-seq
MIRT2462234	hsa-miR-4439	CLIP-seq
MIRT2462235	hsa-miR-4513	CLIP-seq
MIRT2462236	hsa-miR-4670-3p	CLIP-seq
MIRT1450188	hsa-miR-4704-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21613532
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	19273613
GO:0000776	Component	Kinetochore	IDA	20133940
GO:0003682	Function	Chromatin binding	IDA	17897941
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003729	Function	MRNA binding	IDA	17897941
GO:0005515	Function	Protein binding	IPI	12802065, 15654337, 17897941, 18794356, 18981471, 19273613, 20133940, 22253824, 24581499, 24970816
GO:0005634	Component	Nucleus	IDA	15654337
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	17098863, 24315095, 24970816
GO:0005635	Component	Nuclear envelope	IEA
GO:0005643	Component	Nuclear pore	IBA
GO:0005643	Component	Nuclear pore	IDA	9828100, 9864356, 11514627, 12802065
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	11952838, 12802065
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005868	Component	Cytoplasmic dynein complex	IDA	20133940
GO:0006404	Process	RNA import into nucleus	IDA	9864356
GO:0006405	Process	RNA export from nucleus	IMP	11952838
GO:0006406	Process	MRNA export from nucleus	IBA
GO:0006606	Process	Protein import into nucleus	IDA	9864356
GO:0006606	Process	Protein import into nucleus	IMP	11952838
GO:0006606	Process	Protein import into nucleus	IMP	18794356
GO:0006606	Process	Protein import into nucleus	TAS	7798308
GO:0006611	Process	Protein export from nucleus	IMP	11952838
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0006999	Process	Nuclear pore organization	IMP	11952838
GO:0006999	Process	Nuclear pore organization	IMP	15229283
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IMP	20133940
GO:0010793	Process	Regulation of mRNA export from nucleus	IMP	22253824
GO:0010965	Process	Regulation of mitotic sister chromatid separation	IMP	20133940
GO:0015031	Process	Protein transport	IEA
GO:0015631	Function	Tubulin binding	IDA	20133940
GO:0016020	Component	Membrane	IEA
GO:0017056	Function	Structural constituent of nuclear pore	IBA
GO:0017056	Function	Structural constituent of nuclear pore	IDA	22253824
GO:0031072	Function	Heat shock protein binding	IDA	17897941
GO:0031453	Process	Positive regulation of heterochromatin formation	IMP	20407419
GO:0031647	Process	Regulation of protein stability	IMP	21613532
GO:0031965	Component	Nuclear membrane	IDA	9024684, 9828100, 9864356, 11514627, 11839768, 11952838, 12802065, 15229283, 18794356, 20407419, 22253824
GO:0031965	Component	Nuclear membrane	IEA
GO:0031990	Process	MRNA export from nucleus in response to heat stress	IDA	17897941
GO:0032880	Process	Regulation of protein localization	IMP	18981471
GO:0034399	Component	Nuclear periphery	IDA	9024684, 11514627, 11839768, 11952838, 15229283, 22401879
GO:0034399	Component	Nuclear periphery	IEA
GO:0034605	Process	Cellular response to heat	IDA	17897941
GO:0035457	Process	Cellular response to interferon-alpha	ISS
GO:0042306	Process	Regulation of protein import into nucleus	IMP	22253824
GO:0042307	Process	Positive regulation of protein import into nucleus	IMP	18794356
GO:0042405	Component	Nuclear inclusion body	IDA	11514627, 11839768
GO:0042405	Component	Nuclear inclusion body	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	11514627, 12802065
GO:0043495	Function	Protein-membrane adaptor activity	IMP	12802065
GO:0043578	Process	Nuclear matrix organization	IMP	11952838
GO:0044615	Component	Nuclear pore nuclear basket	IDA	9024684, 11839768, 15229283, 18981471
GO:0044615	Component	Nuclear pore nuclear basket	IEA
GO:0045947	Process	Negative regulation of translational initiation	IMP	21613532
GO:0046824	Process	Positive regulation of nucleocytoplasmic transport	IEA
GO:0046825	Process	Regulation of protein export from nucleus	IMP	22253824
GO:0046827	Process	Positive regulation of protein export from nucleus	ISS
GO:0046832	Process	Negative regulation of RNA export from nucleus	IDA	22253824
GO:0046832	Process	Negative regulation of RNA export from nucleus	IMP	21613532
GO:0051019	Function	Mitogen-activated protein kinase binding	IDA	18794356
GO:0051028	Process	MRNA transport	IEA
GO:0051168	Process	Nuclear export	IEA
GO:0051292	Process	Nuclear pore complex assembly	IMP	12802065
GO:0051301	Process	Cell division	IEA
GO:0070840	Function	Dynein complex binding	IDA	20133940
GO:0070849	Process	Response to epidermal growth factor	IDA	18794356
GO:0072686	Component	Mitotic spindle	IDA	20133940
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	18981471, 19273613
GO:0090316	Process	Positive regulation of intracellular protein transport	IEA
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	19273613
GO:1901673	Process	Regulation of mitotic spindle assembly	IBA
GO:1901673	Process	Regulation of mitotic spindle assembly	IMP	19273613

Other IDs

• MIM: 189940
• HGNC: 12017
• e!Ensembl: ENSG00000047410

Protein

• UniProt ID: P12270
• Protein name: Nucleoprotein TPR (Megator) (NPC-associated intranuclear protein) (Translocated promoter region protein)
• Protein function: Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding element in the nuclear phase of the NPC essential for normal nucleocytoplasmic transport of proteins and
• PDB: 5TO5, 5TO6, 5TO7, 5TVB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07926	TPR_MLP1_2	1038 → 1166	TPR/MLP1/MLP2-like protein	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in esophagus, ovary, liver, skin, smooth muscles, cerebrum and fetal cerebellum (at protein level). Highest in testis, lung, thymus, spleen and brain, lower levels in heart, liver and kidney. {ECO:0000269|PubMed:12424524, ECO
• Sequence:

  MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
  LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEEL
  EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYRE
  KRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM
  NGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
  NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLL
  SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
  KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSS
  VLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
  RNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ
  MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVI
  ESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF
  ASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVR
  AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
  IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
  IATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTS
  NVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
  DKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQN
  KYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKD
  EVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL
  RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
  ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
  LQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKA
  EIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRR
  YKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
  QKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
  KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRISRLERELREH
  QERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK
  VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
  FGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEV
  VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLK
  SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
  GPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEDDDDDEDDTG
  MGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHRAADSQNSGEG
  NTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
  IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAG
  VPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAA
  PVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAG
  LEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQGVRGRQ
  FNRQRGVSHAMGGRGGINRGNIN

• Sequence length: 2363

Pathways

KEGG:

Nucleocytoplasmic transport
Amyotrophic lateral sclerosis
Pathways in cancer
Thyroid cancer

Reactome:

ISG15 antiviral mechanism
Transport of the SLBP independent Mature mRNA
Transport of the SLBP Dependant Mature mRNA
Transport of Mature mRNA Derived from an Intronless Transcript
Transport of Mature mRNA derived from an Intron-Containing Transcript
Rev-mediated nuclear export of HIV RNA
Transport of Ribonucleoproteins into the Host Nucleus
NS1 Mediated Effects on Host Pathways
Viral Messenger RNA Synthesis
NEP/NS2 Interacts with the Cellular Export Machinery
Regulation of Glucokinase by Glucokinase Regulatory Protein
Vpr-mediated nuclear import of PICs
snRNP Assembly
SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Nuclear Pore Complex (NPC) Disassembly
Regulation of HSF1-mediated heat shock response
SUMOylation of SUMOylation proteins
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
SUMOylation of DNA replication proteins
Transcriptional regulation by small RNAs
Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
tRNA processing in the nucleus
HCMV Early Events
HCMV Late Events

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Intellectual developmental disorder, autosomal recessive 79	Uncertain significance	rs2526481808, rs2526595403	RCV003229584 RCV003229585
Intellectual disability	Uncertain significance	rs199892357	RCV000578403

Associations from Text Mining
Disease Name	Relationship Type	References
Ataxia	Associate	34494102
Glioma	Associate	36316040
Hypertension	Associate	22384028
Intellectual Disability	Associate	29606577, 34494102
Lesch Nyhan Syndrome	Associate	28056107
Lung Neoplasms	Associate	34793452
Microcephaly	Associate	34494102
Multiple Sclerosis	Associate	22461701
Neoplasm Metastasis	Associate	25559688, 34237031
Neoplasms	Associate	25471943, 27259011, 31792356, 33755158, 34168151, 36316040
Neurologic Manifestations	Associate	34494102
Osteosarcoma	Associate	40321814
Ovarian Neoplasms	Associate	34168151
Pancreatic Neoplasms	Associate	33755158
Progeria	Associate	30565836
Purpura Thrombocytopenic Idiopathic	Associate	33222560
Sarcoma	Associate	32957984
Syphilis	Associate	23898829
Thyroid Neoplasms	Associate	22887574, 32737449