Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7162
Gene name Gene Name - the full gene name approved by the HGNC.
Trophoblast glycoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TPBG
Synonyms (NCBI Gene) Gene synonyms aliases
5T4, 5T4AG, M6P1, WAIF1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q14.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is ass
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020868 hsa-miR-155-5p Proteomics 18668040
MIRT028555 hsa-miR-30a-5p Proteomics 18668040
MIRT031878 hsa-miR-16-5p Proteomics 18668040
MIRT032386 hsa-let-7b-5p Proteomics 18668040
MIRT041063 hsa-miR-505-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 10366710
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
190920 12004 ENSG00000146242
Protein
UniProt ID Q13641
Protein name Trophoblast glycoprotein (5T4 oncofetal antigen) (5T4 oncofetal trophoblast glycoprotein) (5T4 oncotrophoblast glycoprotein) (M6P1) (Wnt-activated inhibitory factor 1) (WAIF1)
Protein function May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
PDB 4CNC , 4CNM , 6HBY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 61 90 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 91 154 Leucine rich repeat Repeat
PF13855 LRR_8 118 168 Leucine rich repeat Repeat
PF13855 LRR_8 210 270 Leucine rich repeat Repeat
PF13855 LRR_8 239 294 Leucine rich repeat Repeat
PF01463 LRRCT 320 345 Leucine rich repeat C-terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed by all types of trophoblasts as early as 9 weeks of development. Specific for trophoblastic cells except for amniotic epithelium. In adult tissues, the expression is limited to a few epithelial cell types but is found on a va
Sequence
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPL
ADLSPFAFSGSNAS
VSAPSPLVELIL
NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD
LSNNSLVSLTYVSFRNLTHLESLHLEDNAL
KVLHNGTLAELQGLPHIRVFLDNN
PWVCDC
HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
Sequence length 420
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35452205
Alzheimer Disease Associate 28183528
Atypical Squamous Cells of the Cervix Associate 2404512
Breast Neoplasms Associate 37495592
Carcinoma Non Small Cell Lung Associate 30736848
Carcinoma Renal Cell Associate 16222313, 31686124
Colorectal Neoplasms Associate 1419629, 16630022, 19221742, 31686124, 8132670, 8180020
Glioblastoma Associate 33553434
Idiopathic Pulmonary Fibrosis Associate 36601116
Inflammation Associate 34580602, 36601116