TP73 (tumor protein p73)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 7161
Gene name Tumor protein p73
Gene symbol TP73
Synonyms (NCBI Gene)
CILD47P73
Chromosome 1
Chromosome location 1p36.32
Summary This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain mul
miRNA miRNA information provided by mirtarbase database.
78
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (78)
miRTarBase ID miRNA Experiments Reference
MIRT005603 hsa-miR-193a-5p ImmunoblotLuciferase reporter assayqRT-PCRWestern blot 21293058
MIRT006897 hsa-miR-205-5p qRT-PCRWestern blot 22871739
MIRT625736 hsa-miR-320a HITS-CLIP 23824327
MIRT625735 hsa-miR-320b HITS-CLIP 23824327
MIRT625734 hsa-miR-320c HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
10
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
Transcription factor Regulation Reference
E2F1 Activation 11115495;12766778;17980704
E2F1 Unknown 11988839;19188449
EGR1 Unknown 16990849
EP300 Activation 11115495
JUN Unknown 15302867
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
87
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (87)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 16343436
GO:0000976 Function Transcription cis-regulatory region binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601990 12003 ENSG00000078900
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15350
Protein name Tumor protein p73 (p53-like transcription factor) (p53-related protein)
Protein function Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor
PDB 1COK , 1DXS , 2KBY , 2MPS , 2NB1 , 2WQI , 2WQJ , 2WTT , 2XWC , 3VD0 , 3VD1 , 3VD2 , 4A63 , 4G82 , 4G83 , 4GUO , 4GUQ , 5HOB , 5HOC , 5KBD , 6FGS , 6IJQ , 7EZJ , 8P9C , 8P9D , 8P9E , 9GLQ , 9GNB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00870 P53 117 → 309 P53 DNA-binding domain Domain
PF07710 P53_tetramer 345 → 384 P53 tetramerisation motif Motif
PF07647 SAM_2 485 → 549 SAM domain (Sterile alpha motif) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in striatal neurons of patients with Huntington disease (at protein level). Brain, kidney, placenta, colon, heart, liver, spleen, skeletal muscle, prostate, thymus and pancreas. Highly expressed in fetal tissue. Expressed in
Sequence 
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Sequence length 636
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  p53 signaling pathway
Hippo signaling pathway
Neurotrophin signaling pathway
Measles 		  Activation of PUMA and translocation to mitochondria
TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
TP53 Regulates Transcription of Caspase Activators and Caspases
TP53 Regulates Transcription of Death Receptors and Ligands
Regulation of TP53 Activity through Association with Co-factors
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
19
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ciliary dyskinesia, primary, 47, and lissencephaly Pathogenic rs2124533497, rs2124524068, rs2124544212, rs2124478772 RCV001553811
RCV001553812
RCV001553813
RCV001553814
Colon adenocarcinoma Pathogenic rs2124533497 RCV005916225
Respiratory failure Pathogenic rs2124478772 RCV001844300
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs192866394 RCV005932660
Neurodevelopmental disorder Uncertain significance rs986713005 RCV001291508
TP73-related disorder Likely benign; Benign rs138694448, rs113253012, rs12046074, rs12048341 RCV003894477
RCV003973830
RCV003964338
RCV003976493
Show/Hide Text Mining Associations (145)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
3 methylcrotonyl CoA carboxylase 1 deficiency Associate 10732753
Abnormal Karyotype Associate 20671427
Acquired Immunodeficiency Syndrome Associate 16135803
Adenocarcinoma Associate 28134496
Adenocarcinoma of Lung Associate 27878984
Adenoma Pleomorphic Associate 23510689
Alzheimer Disease Associate 14720173, 15175114
Ameloblastoma Associate 28025428
Amyotrophic Lateral Sclerosis Associate 35020242
Aneuploidy Associate 33168930