Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7159
Gene name Gene Name - the full gene name approved by the HGNC.
Tumor protein p53 binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TP53BP2
Synonyms (NCBI Gene) Gene synonyms aliases
53BP2, ASPP2, BBP, P53BP2, PPP1R13A
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q41
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear regi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005328 hsa-miR-21-5p Luciferase reporter assay, qRT-PCR 18829576
MIRT036878 hsa-miR-877-3p CLASH 23622248
MIRT036049 hsa-miR-1301-3p CLASH 23622248
MIRT437684 hsa-miR-222-3p Microarray, qRT-PCR 22815788
MIRT1448060 hsa-miR-28-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 15706352
E2F1 Unknown 19610065
RB1 Unknown 19610065
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002039 Function P53 binding IBA
GO:0002039 Function P53 binding IEA
GO:0002039 Function P53 binding IPI 14985081
GO:0005515 Function Protein binding IPI 8875926, 10498867, 10646860, 11278422, 11684014, 12694406, 14729977, 14985081, 15161933, 15231748, 17965023, 18275817, 18448430, 18719108, 19377511, 21513714, 21988832, 21998301, 22321011, 24366813, 24855949, 25344754, 25416956, 25436413, 25502805, 25963096, 26496610, 28330616, 2851
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602143 12000 ENSG00000143514
Protein
UniProt ID Q13625
Protein name Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)
Protein function Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PubMed:12524540). Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters o
PDB 1YCS , 2UWQ , 4A63 , 4IRV , 6GHM , 6HKP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13606 Ank_3 958 987 Ankyrin repeat Repeat
PF00023 Ank 991 1023 Ankyrin repeat Repeat
PF00018 SH3_1 1063 1111 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte. Reduced expression in breast carcinomas expressing a wild-type TP53 protein. Overexpressed in lung cancer ce
Sequence
MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNE
RMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVN
SPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLK
EIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR
QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAV
MDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMP
SRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL
FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS
SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSM
GTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRK
PQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHP
ENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA
LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTAS
SESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN
SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSL
PPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI
TALHNAVCAGHTEIVKFLVQFGVNVNA
ADSDGWTPLHCAASCNNVQVCKFLVESGAAVFA
MTY
SDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKE
GDCMTIIHREDEDEIEWWWARLNDKEGYVPR
NLLGLYPRIKPRQRSLA
Sequence length 1128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hippo signaling pathway   Activation of PUMA and translocation to mitochondria
TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
TP53 Regulates Transcription of Death Receptors and Ligands
Regulation of TP53 Activity through Association with Co-factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 40311306
Breast Neoplasms Associate 26663100, 28179588, 32420372
Carcinogenesis Associate 16098144
Carcinoma Hepatocellular Associate 25032846, 25980493, 26934443, 28351301, 31685796
Carcinoma Hepatocellular Inhibit 36752127
Carcinoma Squamous Cell Associate 29747775
Choriocarcinoma Inhibit 23671128
Depressive Disorder Associate 16098144
Epiretinal Membrane Associate 27378826
Esophageal Squamous Cell Carcinoma Associate 28103919