Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7159
Gene name Gene Name - the full gene name approved by the HGNC.	Tumor protein p53 binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TP53BP2
Synonyms (NCBI Gene) Gene synonyms aliases	53BP2, ASPP2, BBP, P53BP2, PPP1R13A
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q41
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear regi

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005328	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR	18829576
MIRT036878	hsa-miR-877-3p	CLASH	23622248
MIRT036049	hsa-miR-1301-3p	CLASH	23622248
MIRT437684	hsa-miR-222-3p	Microarray, qRT-PCR	22815788
MIRT1448060	hsa-miR-28-3p	CLIP-seq
MIRT1448061	hsa-miR-3160-3p	CLIP-seq
MIRT1448062	hsa-miR-4305	CLIP-seq
MIRT1448063	hsa-miR-4320	CLIP-seq
MIRT1448064	hsa-miR-4436a	CLIP-seq
MIRT1448065	hsa-miR-4699-3p	CLIP-seq
MIRT1448066	hsa-miR-4700-3p	CLIP-seq
MIRT1448067	hsa-miR-578	CLIP-seq
MIRT1448068	hsa-miR-643	CLIP-seq
MIRT1448069	hsa-miR-1207-3p	CLIP-seq
MIRT1448070	hsa-miR-1263	CLIP-seq
MIRT1448071	hsa-miR-1277	CLIP-seq
MIRT1448072	hsa-miR-1283	CLIP-seq
MIRT1448073	hsa-miR-144	CLIP-seq
MIRT1448074	hsa-miR-21	CLIP-seq
MIRT1448075	hsa-miR-2116	CLIP-seq
MIRT1448076	hsa-miR-219-5p	CLIP-seq
MIRT1448060	hsa-miR-28-3p	CLIP-seq
MIRT1448077	hsa-miR-3121-5p	CLIP-seq
MIRT1448078	hsa-miR-3157-5p	CLIP-seq
MIRT1448079	hsa-miR-3189-5p	CLIP-seq
MIRT1448080	hsa-miR-3200-5p	CLIP-seq
MIRT1448081	hsa-miR-370	CLIP-seq
MIRT1448082	hsa-miR-375	CLIP-seq
MIRT1448083	hsa-miR-3924	CLIP-seq
MIRT1448084	hsa-miR-4273	CLIP-seq
MIRT1448085	hsa-miR-4282	CLIP-seq
MIRT1448062	hsa-miR-4305	CLIP-seq
MIRT1448063	hsa-miR-4320	CLIP-seq
MIRT1448086	hsa-miR-4503	CLIP-seq
MIRT1448087	hsa-miR-4677-5p	CLIP-seq
MIRT1448065	hsa-miR-4699-3p	CLIP-seq
MIRT1448088	hsa-miR-4735-5p	CLIP-seq
MIRT1448089	hsa-miR-4758-3p	CLIP-seq
MIRT1448090	hsa-miR-4782-3p	CLIP-seq
MIRT1448067	hsa-miR-578	CLIP-seq
MIRT1448091	hsa-miR-590-5p	CLIP-seq
MIRT1448092	hsa-miR-607	CLIP-seq
MIRT1448093	hsa-miR-628-5p	CLIP-seq
MIRT1448068	hsa-miR-643	CLIP-seq
MIRT2134069	hsa-miR-1207-5p	CLIP-seq
MIRT2134070	hsa-miR-28-5p	CLIP-seq
MIRT2134071	hsa-miR-299-5p	CLIP-seq
MIRT2134072	hsa-miR-3128	CLIP-seq
MIRT2134073	hsa-miR-3139	CLIP-seq
MIRT2134074	hsa-miR-3169	CLIP-seq
MIRT2134075	hsa-miR-421	CLIP-seq
MIRT2134076	hsa-miR-4266	CLIP-seq
MIRT1448064	hsa-miR-4436a	CLIP-seq
MIRT2134077	hsa-miR-4459	CLIP-seq
MIRT2134078	hsa-miR-4515	CLIP-seq
MIRT1448066	hsa-miR-4700-3p	CLIP-seq
MIRT2134079	hsa-miR-4709-5p	CLIP-seq
MIRT2134080	hsa-miR-4720-5p	CLIP-seq
MIRT2134081	hsa-miR-4722-5p	CLIP-seq
MIRT2134082	hsa-miR-4736	CLIP-seq
MIRT2134083	hsa-miR-4763-3p	CLIP-seq
MIRT2134084	hsa-miR-4799-3p	CLIP-seq
MIRT2134085	hsa-miR-570	CLIP-seq
MIRT2134086	hsa-miR-646	CLIP-seq
MIRT2134087	hsa-miR-651	CLIP-seq
MIRT2134088	hsa-miR-708	CLIP-seq
MIRT2355116	hsa-miR-2277-3p	CLIP-seq
MIRT2355117	hsa-miR-3919	CLIP-seq
MIRT2355118	hsa-miR-4501	CLIP-seq
MIRT2355119	hsa-miR-4756-3p	CLIP-seq
MIRT2649029	hsa-miR-300	CLIP-seq
MIRT2649030	hsa-miR-338-5p	CLIP-seq
MIRT2649031	hsa-miR-3614-3p	CLIP-seq
MIRT2649032	hsa-miR-381	CLIP-seq
MIRT2649033	hsa-miR-3944-5p	CLIP-seq
MIRT2649034	hsa-miR-4297	CLIP-seq
MIRT2649035	hsa-miR-4666-3p	CLIP-seq
MIRT2649036	hsa-miR-515-3p	CLIP-seq
MIRT2649037	hsa-miR-519e	CLIP-seq
MIRT2649038	hsa-miR-595	CLIP-seq
MIRT2649039	hsa-miR-648	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
E2F1	Activation	15706352
E2F1	Unknown	19610065
RB1	Unknown	19610065

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002039	Function	P53 binding	IBA
GO:0002039	Function	P53 binding	IEA
GO:0002039	Function	P53 binding	IPI	14985081
GO:0005515	Function	Protein binding	IPI	8875926, 10498867, 10646860, 11278422, 11684014, 12694406, 14729977, 14985081, 15161933, 15231748, 17965023, 18275817, 18448430, 18719108, 19377511, 21513714, 21988832, 21998301, 22321011, 24366813, 24855949, 25344754, 25416956, 25436413, 25502805, 25963096, 26496610, 28330616, 2851
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19377511
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10646860, 14985081, 19377511
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9748285, 15782125
GO:0005829	Component	Cytosol	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	9748285
GO:0017124	Function	SH3 domain binding	IEA
GO:0030054	Component	Cell junction	IDA
GO:0042802	Function	Identical protein binding	IPI	18448430
GO:0042803	Function	Protein homodimerization activity	IPI	25963096
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	TAS	14729977
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10646860
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14985081
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051059	Function	NF-kappaB binding	IPI	10498867
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IDA	11684014
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IMP	14985081

MIM	HGNC	e!Ensembl
602143	12000	ENSG00000143514

Protein

UniProt ID

Q13625

Protein name

Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)

Protein function

Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PubMed:12524540). Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters o

PDB

1YCS , 2UWQ , 4A63 , 4IRV , 6GHM , 6HKP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13606	Ank_3	958 → 987	Ankyrin repeat	Repeat
PF00023	Ank	991 → 1023	Ankyrin repeat	Repeat
PF00018	SH3_1	1063 → 1111	SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte. Reduced expression in breast carcinomas expressing a wild-type TP53 protein. Overexpressed in lung cancer ce

Sequence

MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNE
RMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVN
SPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLK
EIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR
QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAV
MDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMP
SRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL
FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS
SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSM
GTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRK
PQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHP
ENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA
LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTAS
SESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN
SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSL
PPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI
TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFA
MTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKE
GDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA

Sequence length

1128

Interactions

View interactions

	KEGG		Reactome
	Hippo signaling pathway		Activation of PUMA and translocation to mitochondria TP53 Regulates Transcription of Genes Involved in Cytochrome C Release TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain TP53 Regulates Transcription of Death Receptors and Ligands Regulation of TP53 Activity through Association with Co-factors

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	40311306
Breast Neoplasms	Associate	26663100, 28179588, 32420372
Carcinogenesis	Associate	16098144
Carcinoma Hepatocellular	Associate	25032846, 25980493, 26934443, 28351301, 31685796
Carcinoma Hepatocellular	Inhibit	36752127
Carcinoma Squamous Cell	Associate	29747775
Choriocarcinoma	Inhibit	23671128
Depressive Disorder	Associate	16098144
Epiretinal Membrane	Associate	27378826
Esophageal Squamous Cell Carcinoma	Associate	28103919
Esophageal Squamous Cell Carcinoma	Inhibit	29747775
Genetic Diseases Inborn	Associate	33678339
Gestational Trophoblastic Disease	Associate	31615473
Glaucoma Open Angle	Associate	28150229
Hepatitis B Chronic	Associate	37858684
Inflammation	Associate	27378826
Leukemia	Associate	24312201, 35780096
Leukemia Myeloid Acute	Associate	24312201, 30952616
Lung Neoplasms	Associate	40311306
Lymphatic Metastasis	Associate	29747775
Mitochondrial Diseases	Inhibit	16098144
Neoplasm Metastasis	Associate	28103919, 29747775
Neoplasms	Associate	15757645, 16887812, 21562218, 22248188, 25436413, 26438046, 28179588, 30952616, 31424649
Neoplasms	Inhibit	23248303, 23671128, 24312201, 24474782, 26595804, 31685796, 31964836, 35780096, 36752127
Pancreatic Neoplasms	Inhibit	26438046
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	24312201
Retinitis	Associate	28150229
Sarcoma	Associate	35780096
Squamous Cell Carcinoma of Head and Neck	Associate	29443735
Triple Negative Breast Neoplasms	Associate	30305342, 32420372
Uterine Cervical Dysplasia	Inhibit	29747775
Vitreoretinopathy Proliferative	Associate	27378826

TP53BP2 (tumor protein p53 binding protein 2)