Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7106
Gene name Gene Name - the full gene name approved by the HGNC.	Tetraspanin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TSPAN4
Synonyms (NCBI Gene) Gene synonyms aliases	NAG-2, NAG2, TETRASPAN, TM4SF7, TSPAN-4
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

Show/Hide all(20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004983	hsa-miR-1-3p	Microarray	15685193
MIRT004983	hsa-miR-1-3p	Microarray	15685193
MIRT2138008	hsa-miR-1	CLIP-seq
MIRT2138009	hsa-miR-1225-3p	CLIP-seq
MIRT2138010	hsa-miR-206	CLIP-seq
MIRT2138011	hsa-miR-3180-5p	CLIP-seq
MIRT2138012	hsa-miR-3673	CLIP-seq
MIRT2138013	hsa-miR-3688-3p	CLIP-seq
MIRT2138014	hsa-miR-4301	CLIP-seq
MIRT2138015	hsa-miR-4323	CLIP-seq
MIRT2138016	hsa-miR-4426	CLIP-seq
MIRT2138017	hsa-miR-4647	CLIP-seq
MIRT2138018	hsa-miR-4662b	CLIP-seq
MIRT2138019	hsa-miR-4733-3p	CLIP-seq
MIRT2138020	hsa-miR-4758-3p	CLIP-seq
MIRT2138021	hsa-miR-501-3p	CLIP-seq
MIRT2138022	hsa-miR-502-3p	CLIP-seq
MIRT2138023	hsa-miR-613	CLIP-seq
MIRT2138024	hsa-miR-665	CLIP-seq
MIRT2138025	hsa-miR-767-5p	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003823	Function	Antigen binding	IDA	9360996
GO:0005178	Function	Integrin binding	IPI	9360996
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9360996
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0016020	Component	Membrane	IEA
GO:0031982	Component	Vesicle	IDA	9360996
GO:0065003	Process	Protein-containing complex assembly	IDA	9360996

MIM	HGNC	e!Ensembl
602644	11859	ENSG00000214063

Protein

UniProt ID

O14817

Protein name

Tetraspanin-4 (Tspan-4) (Novel antigen 2) (NAG-2) (Transmembrane 4 superfamily member 7)

Protein function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Plays an essential role in migrasome formation and migration on retractin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	9 → 229	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in multiple tissues but is absent in brain, lymphoid cells, and platelets.

Sequence

MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT
GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLK
KGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH
APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Sequence length

238

Interactions

View interactions

TSPAN4 (tetraspanin 4)