Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7098
Gene name Gene Name - the full gene name approved by the HGNC.
Toll like receptor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLR3
Synonyms (NCBI Gene) Gene synonyms aliases
CD283, IIAE2, IMD83
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q35.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35311343 C>G Likely-benign, risk-factor Missense variant, coding sequence variant
rs121434431 C>T Risk-factor, uncertain-significance Missense variant, coding sequence variant
rs199768900 G>A Risk-factor Coding sequence variant, missense variant
rs768091235 T>C Risk-factor Coding sequence variant, missense variant
rs1244010954 G>A,T Risk-factor Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022528 hsa-miR-124-3p Microarray 18668037
MIRT438603 hsa-miR-758-3p Luciferase reporter assay, Western blot, qRT-PCR 25008898
MIRT438603 hsa-miR-758-3p Luciferase reporter assay, Western blot, qRT-PCR 25008898
MIRT564104 hsa-miR-548e-5p PAR-CLIP 20371350
MIRT564103 hsa-miR-3662 PAR-CLIP 20371350
Transcription factors
Transcription factor Regulation Reference
E2F1 Repression 22310660
IRF3 Unknown 22208359
IRF8 Repression 21220691
NFKB1 Activation 20658750
NFKB1 Repression 16423052
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0000165 Process MAPK cascade IEA
GO:0001774 Process Microglial cell activation IEA
GO:0002224 Process Toll-like receptor signaling pathway IDA 12471095
GO:0002224 Process Toll-like receptor signaling pathway IDA 18172197
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603029 11849 ENSG00000164342
Protein
UniProt ID O15455
Protein name Toll-like receptor 3 (CD antigen CD283)
Protein function Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR3 is a nucleotide-sensing TLR which is activated by
PDB 1ZIW , 2A0Z , 2MK9 , 2MKA , 3ULU , 3ULV , 5GS0 , 7C76 , 7WV3 , 7WV4 , 7WV5 , 7WVE , 7WVF , 7WVJ , 8AR1 , 8YHT , 8YHU , 9LSH , 9LSI , 9LSJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 51 111 Leucine rich repeat Repeat
PF13516 LRR_6 195 210 Leucine Rich repeat Repeat
PF13855 LRR_8 248 302 Leucine rich repeat Repeat
PF13855 LRR_8 274 332 Leucine rich repeat Repeat
PF13855 LRR_8 562 620 Leucine rich repeat Repeat
PF13855 LRR_8 586 647 Leucine rich repeat Repeat
PF17968 Tlr3_TMD 698 730 Toll-like receptor 3 trans-membrane domain Domain
PF01582 TIR 755 897 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed at high level in placenta and pancreas. Also detected in CD11c+ immature dendritic cells. Only expressed in dendritic cells and not in other leukocytes, including monocyte precursors. TLR3 is the TLR that is expressed most st
Sequence
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNEL
SQLSDKTFA
FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN
NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK
LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
EY
FFLEYNNIQHLFSHSLHGLFNVRYLNLKRS
FTKQSISLASLPKIDDFSFQWLKCLEHL
NMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP
SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN
NLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKN
LITSVEKKVFGPAFRNLTELDMRFNPF
DCTCESIAWFVNW
INETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV
LLIHFEGWRI
SFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKE
DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVAL
GSK
NSVH
Sequence length 904
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Necroptosis
Toll-like receptor signaling pathway
Hepatitis C
Hepatitis B
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Coronavirus disease - COVID-19
  Trafficking and processing of endosomal TLR
Toll Like Receptor 3 (TLR3) Cascade
TICAM1, RIP1-mediated IKK complex recruitment
RIP-mediated NFkB activation via ZBP1
TLR3 deficiency - HSE
UNC93B1 deficiency - HSE
TICAM1 deficiency - HSE
TRAF3 deficiency - HSE
TLR3-mediated TICAM1-dependent programmed cell death
TICAM1-dependent activation of IRF3/IRF7
TICAM1,TRAF6-dependent induction of TAK1 complex
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Immunodeficiency Immunodeficiency 83, susceptibility to viral infections, immunodeficiency 83, susceptibility to viral infections N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Achalasia Addisonianism Alacrimia syndrome Associate 29567028
Acute On Chronic Liver Failure Associate 28592438, 34774066
Adenocarcinoma of Lung Associate 37746997
Adenomatous Polyposis Coli Associate 38073344
AIDS Arteritis Central Nervous System Stimulate 29128906
Alzheimer Disease Associate 17652175
Alzheimer Disease Stimulate 30076830
Anemia Associate 24445780
Aortic Aneurysm Abdominal Associate 29567028, 32284335
Aortic Aneurysm Thoracic Associate 29486395