Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7090
Gene name Gene Name - the full gene name approved by the HGNC.
TLE family member 3, transcriptional corepressor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLE3
Synonyms (NCBI Gene) Gene synonyms aliases
ESG, ESG3, GRG3, HsT18976
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcriptional co-repressor protein that belongs to the transducin-like enhancer family of proteins. The members of this family function in the Notch signaling pathway that regulates determination of cell fate during development. Expr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025609 hsa-miR-10a-5p Sequencing 20371350
MIRT050664 hsa-miR-18a-5p CLASH 23622248
MIRT049557 hsa-miR-92a-3p CLASH 23622248
MIRT048880 hsa-miR-93-5p CLASH 23622248
MIRT047341 hsa-miR-34a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003714 Function Transcription corepressor activity IBA
GO:0005515 Function Protein binding IPI 17577209, 22304967, 26235987, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 22304967
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600190 11839 ENSG00000140332
Protein
UniProt ID Q04726
Protein name Transducin-like enhancer protein 3 (Enhancer of split groucho-like protein 3) (ESG3)
Protein function Transcriptional corepressor that binds to a number of transcription factors (PubMed:28689657). Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling (PubMed:28689657). The effects of full-length TLE f
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03920 TLE_N 1 133 Groucho/TLE N-terminal Q-rich domain Family
PF00400 WD40 477 513 WD domain, G-beta repeat Repeat
PF00400 WD40 608 646 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Placenta and lung. {ECO:0000269|PubMed:1303260}.
Sequence
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHL
SHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTV
KDEKNHHELDHRERESSANNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTP
ISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGA
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQI
NTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWD
ISQPGSKSPISQLDCLNRDNYIRSCKL
LPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTS
QIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGK
DNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
Sequence length 772
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Wnt signaling pathway
Notch signaling pathway
  Formation of the beta-catenin:TCF transactivating complex
Deactivation of the beta-catenin transactivating complex
Repression of WNT target genes
Estrogen-dependent gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 36320054
Breast Neoplasms Associate 36696357
Diabetes Mellitus Type 2 Associate 30649532
Intellectual Disability Associate 36320054
Leukemia Myeloid Acute Associate 34551306
Neoplasm Metastasis Inhibit 31243372, 36696357
Neoplasms Associate 26284338, 28859615
Ovarian Neoplasms Associate 29531130
Prostatic Neoplasms Associate 31243372, 31855178
Triple Negative Breast Neoplasms Associate 28859615