Gene Gene information from NCBI Gene database.
Entrez ID 7090
Gene name TLE family member 3, transcriptional corepressor
Gene symbol TLE3
Synonyms (NCBI Gene)
ESGESG3GRG3HsT18976
Chromosome 15
Chromosome location 15q23
Summary This gene encodes a transcriptional co-repressor protein that belongs to the transducin-like enhancer family of proteins. The members of this family function in the Notch signaling pathway that regulates determination of cell fate during development. Expr
miRNA miRNA information provided by mirtarbase database.
617
miRTarBase ID miRNA Experiments Reference
MIRT025609 hsa-miR-10a-5p Sequencing 20371350
MIRT050664 hsa-miR-18a-5p CLASH 23622248
MIRT049557 hsa-miR-92a-3p CLASH 23622248
MIRT048880 hsa-miR-93-5p CLASH 23622248
MIRT047341 hsa-miR-34a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0003714 Function Transcription corepressor activity IBA
GO:0005515 Function Protein binding IPI 17577209, 22304967, 26235987, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 22304967
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600190 11839 ENSG00000140332
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04726
Protein name Transducin-like enhancer protein 3 (Enhancer of split groucho-like protein 3) (ESG3)
Protein function Transcriptional corepressor that binds to a number of transcription factors (PubMed:28689657). Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling (PubMed:28689657). The effects of full-length TLE f
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03920 TLE_N 1 133 Groucho/TLE N-terminal Q-rich domain Family
PF00400 WD40 477 513 WD domain, G-beta repeat Repeat
PF00400 WD40 608 646 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Placenta and lung. {ECO:0000269|PubMed:1303260}.
Sequence
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHL
SHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTV
KDEKNHHELDHRERESSANNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTP
ISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGA
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQI
NTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWD
ISQPGSKSPISQLDCLNRDNYIRSCKL
LPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTS
QIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGK
DNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
Sequence length 772
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Wnt signaling pathway
Notch signaling pathway
  Formation of the beta-catenin:TCF transactivating complex
Deactivation of the beta-catenin transactivating complex
Repression of WNT target genes
Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
TLE3-related condition Uncertain significance rs2542812727 RCV004758916
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 36320054
Breast Neoplasms Associate 36696357
Diabetes Mellitus Type 2 Associate 30649532
Intellectual Disability Associate 36320054
Leukemia Myeloid Acute Associate 34551306
Neoplasm Metastasis Inhibit 31243372, 36696357
Neoplasms Associate 26284338, 28859615
Ovarian Neoplasms Associate 29531130
Prostatic Neoplasms Associate 31243372, 31855178
Triple Negative Breast Neoplasms Associate 28859615