Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7079
Gene name Gene Name - the full gene name approved by the HGNC.	TIMP metallopeptidase inhibitor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TIMP4
Synonyms (NCBI Gene) Gene synonyms aliases	TIMP-4
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p25.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein

Show/Hide all(50)

miRTarBase ID	miRNA	Experiments
MIRT1425431	hsa-miR-1183	CLIP-seq
MIRT1425432	hsa-miR-1237	CLIP-seq
MIRT1425433	hsa-miR-3162-3p	CLIP-seq
MIRT1425434	hsa-miR-4713-5p	CLIP-seq
MIRT1425435	hsa-miR-4762-3p	CLIP-seq
MIRT2349242	hsa-miR-3127-3p	CLIP-seq
MIRT2349243	hsa-miR-3677-5p	CLIP-seq
MIRT2349244	hsa-miR-4312	CLIP-seq
MIRT2349245	hsa-miR-4435	CLIP-seq
MIRT2349246	hsa-miR-4494	CLIP-seq
MIRT2349247	hsa-miR-4645-3p	CLIP-seq
MIRT2349248	hsa-miR-670	CLIP-seq
MIRT2642615	hsa-miR-1184	CLIP-seq
MIRT2642616	hsa-miR-1205	CLIP-seq
MIRT2642617	hsa-miR-125a-3p	CLIP-seq
MIRT2642618	hsa-miR-146a	CLIP-seq
MIRT2642619	hsa-miR-146b-5p	CLIP-seq
MIRT2642620	hsa-miR-1909	CLIP-seq
MIRT2642621	hsa-miR-3158-5p	CLIP-seq
MIRT2642622	hsa-miR-3194-3p	CLIP-seq
MIRT2642623	hsa-miR-3926	CLIP-seq
MIRT2642624	hsa-miR-3934	CLIP-seq
MIRT2642625	hsa-miR-4428	CLIP-seq
MIRT2642626	hsa-miR-4436a	CLIP-seq
MIRT2642627	hsa-miR-451b	CLIP-seq
MIRT2642628	hsa-miR-4533	CLIP-seq
MIRT2642629	hsa-miR-4747-5p	CLIP-seq
MIRT2642630	hsa-miR-548s	CLIP-seq
MIRT2642631	hsa-miR-764	CLIP-seq
MIRT2642632	hsa-miR-885-3p	CLIP-seq
MIRT2642633	hsa-miR-892b	CLIP-seq
MIRT2642615	hsa-miR-1184	CLIP-seq
MIRT2642616	hsa-miR-1205	CLIP-seq
MIRT2642617	hsa-miR-125a-3p	CLIP-seq
MIRT2642618	hsa-miR-146a	CLIP-seq
MIRT2642619	hsa-miR-146b-5p	CLIP-seq
MIRT2642620	hsa-miR-1909	CLIP-seq
MIRT2642621	hsa-miR-3158-5p	CLIP-seq
MIRT2642622	hsa-miR-3194-3p	CLIP-seq
MIRT2642623	hsa-miR-3926	CLIP-seq
MIRT2642624	hsa-miR-3934	CLIP-seq
MIRT2642625	hsa-miR-4428	CLIP-seq
MIRT2642626	hsa-miR-4436a	CLIP-seq
MIRT2642627	hsa-miR-451b	CLIP-seq
MIRT2642628	hsa-miR-4533	CLIP-seq
MIRT2642629	hsa-miR-4747-5p	CLIP-seq
MIRT2642630	hsa-miR-548s	CLIP-seq
MIRT2642631	hsa-miR-764	CLIP-seq
MIRT2642632	hsa-miR-885-3p	CLIP-seq
MIRT2642633	hsa-miR-892b	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IBA	21873635
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0008150	Process	Biological_process	ND
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA	21873635
GO:0008191	Function	Metalloendopeptidase inhibitor activity	NAS	8939999
GO:0009725	Process	Response to hormone	IBA	21873635
GO:0010033	Process	Response to organic substance	IBA	21873635
GO:0010951	Process	Negative regulation of endopeptidase activity	IBA	21873635
GO:0030017	Component	Sarcomere	IEA
GO:0031012	Component	Extracellular matrix	IBA	21873635
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034097	Process	Response to cytokine	IBA	21873635
GO:0042493	Process	Response to drug	IEA
GO:0042698	Process	Ovulation cycle	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IBA	21873635

MIM	HGNC	e!Ensembl
601915	11823	ENSG00000157150

Protein

UniProt ID

Q99727

Protein name

Metalloproteinase inhibitor 4 (Tissue inhibitor of metalloproteinases 4) (TIMP-4)

Protein function

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00965	TIMP	28 → 207	Tissue inhibitor of metalloproteinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundant in heart and present at low levels in many other tissues.

Sequence

MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPA
SADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQV
LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTD
WLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Sequence length

224

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Text Mining Associations (56)

Disease Name	Relationship Type	References
Associations from Text Mining
Aneurysm	Stimulate	26539497
Aneurysm	Associate	27381111
Ankyloblepharon filiforme adnatum	Associate	27876897
Aortic Valve Stenosis	Associate	33129260
Arthritis Rheumatoid	Inhibit	34290266
Astrocytoma	Associate	20693981
Atrial Fibrillation	Inhibit	26319023, 33129260
Atrial Remodeling	Associate	19815660
Blood Platelet Disorders	Associate	12466243
Breast Neoplasms	Associate	22994744, 27187039, 31568637, 8939999
Carcinogenesis	Associate	26291714
Carcinoma Hepatocellular	Associate	24903383
Cardiomyopathies	Associate	21765125
Cardiomyopathy Dilated	Associate	27890770
Cardiomyopathy Restrictive	Inhibit	27233359
Cataract	Associate	26539028
Cleft Lip	Associate	27876897
Colorectal Neoplasms	Associate	19383344
Craniopharyngioma	Associate	24934367
Cystic Fibrosis	Stimulate	23516586
Diabetic Retinopathy	Associate	16186340
Glaucoma Open Angle	Stimulate	26539028
Glioblastoma	Associate	20693981, 34781885
Glioma	Associate	11437402
Heart Defects Congenital	Associate	10922384
Heart Failure Diastolic	Associate	21350055
Hypertrophy Left Ventricular	Associate	19815660
Hypoxia	Inhibit	19661326
Idiopathic Pulmonary Fibrosis	Associate	10956632
Intracranial Aneurysm	Associate	27381111
Liver Cirrhosis	Stimulate	23516586
Liver Failure	Stimulate	23516586
Melanosis	Inhibit	35840442
Meningism	Inhibit	21521415
Neoplasm Metastasis	Associate	22994744
Neoplasms	Inhibit	15928670
Neoplasms	Associate	23167379, 27187039
Neurofibrosarcoma	Associate	15255999
Osteoarthritis	Inhibit	14730609, 20650323
Ovarian Neoplasms	Associate	24116163
Pancreatic Neoplasms	Associate	17873896
Pelvic Organ Prolapse	Inhibit	23683672
Pelvic Organ Prolapse	Associate	24343133
Plaque Atherosclerotic	Associate	26947595
Prostatic Neoplasms	Associate	15928670
Pulmonary Disease Chronic Obstructive	Inhibit	31143784
Renal Insufficiency	Associate	34582968
Retinal Vein Occlusion	Associate	25978399
Squamous Cell Carcinoma of Head and Neck	Associate	31795200
Tuberous Sclerosis	Associate	31183875
Univentricular Heart	Associate	37770592
Uterine Cervical Neoplasms	Associate	15816637, 26291714
Varicose Ulcer	Associate	27460704
Varicose Veins	Associate	29267209
Ventricular Dysfunction Right	Associate	29050751
Weight Loss	Associate	28578327

TIMP4 (TIMP metallopeptidase inhibitor 4)