THRSP (thyroid hormone responsive)

Gene

• Entrez ID: 7069
• Gene name: Thyroid hormone responsive
• Gene symbol: THRSP
• Synonyms (NCBI Gene): LPGP1, Lpgp, S14, SPOT14, THRP
• Chromosome: 11
• Chromosome location: 11q14.1
• Summary: The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocy

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1423708	hsa-miR-129-3p	CLIP-seq
MIRT1423709	hsa-miR-302a	CLIP-seq
MIRT1423710	hsa-miR-302b	CLIP-seq
MIRT1423711	hsa-miR-302c	CLIP-seq
MIRT1423712	hsa-miR-302d	CLIP-seq
MIRT1423713	hsa-miR-302e	CLIP-seq
MIRT1423714	hsa-miR-3140-3p	CLIP-seq
MIRT1423715	hsa-miR-372	CLIP-seq
MIRT1423716	hsa-miR-373	CLIP-seq
MIRT1423717	hsa-miR-4480	CLIP-seq
MIRT1423718	hsa-miR-4687-5p	CLIP-seq
MIRT1423719	hsa-miR-4717-3p	CLIP-seq
MIRT1423720	hsa-miR-520a-3p	CLIP-seq
MIRT1423721	hsa-miR-520b	CLIP-seq
MIRT1423722	hsa-miR-520c-3p	CLIP-seq
MIRT1423723	hsa-miR-520d-3p	CLIP-seq
MIRT1423724	hsa-miR-520e	CLIP-seq
MIRT1423725	hsa-miR-520f	CLIP-seq
MIRT2126924	hsa-miR-1290	CLIP-seq
MIRT2126925	hsa-miR-3167	CLIP-seq
MIRT2126926	hsa-miR-876-5p	CLIP-seq
MIRT2348872	hsa-let-7a	CLIP-seq
MIRT2348873	hsa-let-7b	CLIP-seq
MIRT2348874	hsa-let-7c	CLIP-seq
MIRT2348875	hsa-let-7d	CLIP-seq
MIRT2348876	hsa-let-7e	CLIP-seq
MIRT2348877	hsa-let-7f	CLIP-seq
MIRT2348878	hsa-let-7g	CLIP-seq
MIRT2348879	hsa-let-7i	CLIP-seq
MIRT2348880	hsa-miR-1294	CLIP-seq
MIRT2348881	hsa-miR-202	CLIP-seq
MIRT2348882	hsa-miR-2110	CLIP-seq
MIRT2348883	hsa-miR-3150a-3p	CLIP-seq
MIRT2348884	hsa-miR-3175	CLIP-seq
MIRT2348885	hsa-miR-3927	CLIP-seq
MIRT2348886	hsa-miR-3935	CLIP-seq
MIRT2348887	hsa-miR-4316	CLIP-seq
MIRT2348888	hsa-miR-4458	CLIP-seq
MIRT2348889	hsa-miR-4500	CLIP-seq
MIRT2348890	hsa-miR-4716-3p	CLIP-seq
MIRT2348891	hsa-miR-4723-5p	CLIP-seq
MIRT2348892	hsa-miR-577	CLIP-seq
MIRT2348893	hsa-miR-656	CLIP-seq
MIRT2348894	hsa-miR-939	CLIP-seq
MIRT2348895	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NR1I2	Activation	19437491
SREBF1	Unknown	22672904

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	9003802
GO:0009617	Process	Response to bacterium	IEA
GO:0010866	Process	Regulation of triglyceride biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	IBA
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	ISS
GO:0140678	Function	Molecular function inhibitor activity	IEA

Other IDs

• MIM: 601926
• HGNC: 11800
• e!Ensembl: ENSG00000151365

Protein

• UniProt ID: Q92748
• Protein name: Thyroid hormone-inducible hepatic protein (Spot 14 protein) (S14) (SPOT14)
• Protein function: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07084	Spot_14	1 → 145	Thyroid hormone-inducible hepatic protein Spot 14	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in tissues that synthesize triglycerides.
• Sequence:

  MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYF
  TMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSL
  HHILMHLTEKAQEVTRKYQEMTGQVW

• Sequence length: 146

Pathways

Reactome:

Carnitine metabolism