TSPO (translocator protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
706
Gene name Gene Name - the full gene name approved by the HGNC.
Translocator protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSPO
Synonyms (NCBI Gene) Gene synonyms aliases
BPBS, BZRP, DBI, IBP, MBR, PBR, PBS, PKBS, PTBR, TSPO1, mDRC, pk18
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PBS
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholestero
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT2138125 hsa-miR-298 CLIP-seq
MIRT2359100 hsa-miR-1197 CLIP-seq
MIRT2138125 hsa-miR-298 CLIP-seq
MIRT2359101 hsa-miR-4436a CLIP-seq
MIRT2359102 hsa-miR-4700-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(50)
GO ID Ontology Definition Evidence Reference
GO:0005497 Function Androgen binding IEA
GO:0005515 Function Protein binding IPI 17143515, 25416956, 31515488, 32296183
GO:0005739 Component Mitochondrion IDA
GO:0005741 Component Mitochondrial outer membrane TAS
GO:0005783 Component Endoplasmic reticulum IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
109610 1158 ENSG00000100300
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P30536
Protein name Translocator protein (Mitochondrial benzodiazepine receptor) (PKBS) (Peripheral-type benzodiazepine receptor) (PBR)
Protein function Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its preci
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03073 TspO_MBR 10 → 156 TspO/MBR family Family
Tissue specificity TISSUE SPECIFICITY: Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids. {ECO:0000269|PubMed:20600583}.
Sequence
Sequence length 169
UniProt ID B1AH88
Protein name Putative peripheral benzodiazepine receptor-related protein
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence 
MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLR
MAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS
Sequence length 102
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Cholesterol metabolism
Human T-cell leukemia virus 1 infection 		  Pregnenolone biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Liver failure Chronic Liver Failure rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116
View all (10 more)		 15025246
Show/Hide Text Mining Associations (117)
Associations from Text Mining
Disease Name Relationship Type References
AA amyloidosis Associate 25840980
Adenoma Stimulate 22645299
Alcoholism Associate 28072413
Alzheimer Disease Associate 25840980, 26762507, 31256132, 31276244, 31536662, 32842621, 35522669, 37580767, 40187909
Alzheimer Disease Stimulate 37801139
Anxiety Associate 24998961
Anxiety Disorders Associate 26750656
Arthritis Rheumatoid Associate 29301931, 31260948
Astrocytoma Associate 10880761, 17520179, 25722450
Autism Spectrum Disorder Inhibit 32076115