TSPO (translocator protein)

Gene

• Entrez ID: 706
• Gene name: Translocator protein
• Gene symbol: TSPO
• Synonyms (NCBI Gene): BPBS, BZRP, DBI, IBP, MBR, PBR, PBS, PKBS, PTBR, TSPO1, mDRC, pk18
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholestero

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2138125	hsa-miR-298	CLIP-seq
MIRT2359100	hsa-miR-1197	CLIP-seq
MIRT2138125	hsa-miR-298	CLIP-seq
MIRT2359101	hsa-miR-4436a	CLIP-seq
MIRT2359102	hsa-miR-4700-3p	CLIP-seq
MIRT2359103	hsa-miR-4716-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005497	Function	Androgen binding	IEA
GO:0005515	Function	Protein binding	IPI	17143515, 25416956, 28514442, 31515488, 32296183, 33961781, 37047353
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	8307574
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006626	Process	Protein targeting to mitochondrion	TAS	1326278
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006700	Process	C21-steroid hormone biosynthetic process	TAS
GO:0006783	Process	Heme biosynthetic process	TAS	16822554
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006820	Process	Monoatomic anion transport	TAS	16822554
GO:0006821	Process	Chloride transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008202	Process	Steroid metabolic process	TAS	16822554
GO:0008347	Process	Glial cell migration	IEA
GO:0008503	Function	Benzodiazepine receptor activity	IEA
GO:0008503	Function	Benzodiazepine receptor activity	TAS	1326278
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010042	Process	Response to manganese ion	IEA
GO:0010266	Process	Response to vitamin B1	IEA
GO:0014012	Process	Peripheral nervous system axon regeneration	IEA
GO:0015485	Function	Cholesterol binding	TAS	16822554
GO:0015918	Process	Sterol transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030325	Process	Adrenal gland development	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032374	Process	Regulation of cholesterol transport	TAS	16822554
GO:0032570	Process	Response to progesterone	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0042127	Process	Regulation of cell population proliferation	TAS	16822554
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0048265	Process	Response to pain	IEA
GO:0048266	Process	Behavioral response to pain	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0050810	Process	Regulation of steroid biosynthetic process	IEA
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IEA
GO:0060242	Process	Contact inhibition	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060253	Process	Negative regulation of glial cell proliferation	IEA
GO:0062100	Process	Positive regulation of programmed necrotic cell death	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071294	Process	Cellular response to zinc ion	IEA
GO:0071476	Process	Cellular hypotonic response	IEA
GO:0072655	Process	Establishment of protein localization to mitochondrion	IEA
GO:0072656	Process	Maintenance of protein location in mitochondrion	IEA
GO:0120020	Function	Cholesterol transfer activity	TAS
GO:1901525	Process	Negative regulation of mitophagy	IEA
GO:1903579	Process	Negative regulation of ATP metabolic process	IEA
GO:1905144	Process	Response to acetylcholine	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA
GO:2000853	Process	Negative regulation of corticosterone secretion	IEA

Other IDs

• MIM: 109610
• HGNC: 1158
• e!Ensembl: ENSG00000100300

Protein

• UniProt ID: P30536
• Protein name: Translocator protein (Mitochondrial benzodiazepine receptor) (PKBS) (Peripheral-type benzodiazepine receptor) (PBR)
• Protein function: Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its preci
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03073	TspO_MBR	10 → 156	TspO/MBR family	Family

• Tissue specificity: TISSUE SPECIFICITY: Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids. {ECO:0000269|PubMed:20600583}.
• Sequence:

  MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
  GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
  ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE

• Sequence length: 169
• UniProt ID: B1AH88
• Protein name: Putative peripheral benzodiazepine receptor-related protein
• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLR
  MAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS

• Sequence length: 102

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Cholesterol metabolism
Human T-cell leukemia virus 1 infection

Reactome:

Pregnenolone biosynthesis