Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7033
Gene name Gene Name - the full gene name approved by the HGNC.	Trefoil factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TFF3
Synonyms (NCBI Gene) Gene synonyms aliases	ITF, P1B, TFI
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are

Show/Hide all(117)

miRTarBase ID	miRNA	Experiments
MIRT1420576	hsa-miR-1254	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420583	hsa-miR-3116	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT1420591	hsa-miR-4705	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT1420596	hsa-miR-515-3p	CLIP-seq
MIRT1420597	hsa-miR-519e	CLIP-seq
MIRT1420598	hsa-miR-550a	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420602	hsa-miR-885-3p	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT2126311	hsa-miR-1285	CLIP-seq
MIRT2126312	hsa-miR-1304	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT2126313	hsa-miR-3187-5p	CLIP-seq
MIRT2126314	hsa-miR-320a	CLIP-seq
MIRT2126315	hsa-miR-320b	CLIP-seq
MIRT2126316	hsa-miR-320c	CLIP-seq
MIRT2126317	hsa-miR-320d	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT2126318	hsa-miR-4328	CLIP-seq
MIRT2126319	hsa-miR-4429	CLIP-seq
MIRT2126320	hsa-miR-4475	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT2126321	hsa-miR-4771	CLIP-seq
MIRT2126322	hsa-miR-4780	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT2126323	hsa-miR-518e	CLIP-seq
MIRT2126324	hsa-miR-612	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT2126325	hsa-miR-7	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq
MIRT2126326	hsa-miR-938	CLIP-seq
MIRT2348302	hsa-miR-1207-3p	CLIP-seq
MIRT1420576	hsa-miR-1254	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT2348303	hsa-miR-1273g	CLIP-seq
MIRT2348304	hsa-miR-140-5p	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420583	hsa-miR-3116	CLIP-seq
MIRT2348305	hsa-miR-3135b	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT2126314	hsa-miR-320a	CLIP-seq
MIRT2126315	hsa-miR-320b	CLIP-seq
MIRT2126316	hsa-miR-320c	CLIP-seq
MIRT2126317	hsa-miR-320d	CLIP-seq
MIRT2348306	hsa-miR-323b-5p	CLIP-seq
MIRT2348307	hsa-miR-324-5p	CLIP-seq
MIRT2348308	hsa-miR-3611	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT2348309	hsa-miR-3689d	CLIP-seq
MIRT2348310	hsa-miR-3907	CLIP-seq
MIRT2348311	hsa-miR-3909	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT2126318	hsa-miR-4328	CLIP-seq
MIRT2126319	hsa-miR-4429	CLIP-seq
MIRT2126320	hsa-miR-4475	CLIP-seq
MIRT2348312	hsa-miR-4511	CLIP-seq
MIRT2348313	hsa-miR-4693-3p	CLIP-seq
MIRT1420591	hsa-miR-4705	CLIP-seq
MIRT2348314	hsa-miR-4707-5p	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT2348315	hsa-miR-486-3p	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT1420596	hsa-miR-515-3p	CLIP-seq
MIRT2126323	hsa-miR-518e	CLIP-seq
MIRT1420597	hsa-miR-519e	CLIP-seq
MIRT1420598	hsa-miR-550a	CLIP-seq
MIRT2348316	hsa-miR-615-3p	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT2126325	hsa-miR-7	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420602	hsa-miR-885-3p	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
CDX2	Activation	17182120
CEBPB	Unknown	12297725
ERG	Unknown	21170267
NFKB1	Activation	12912861
NFKB1	Unknown	12297725
RELA	Activation	12912861
RELA	Unknown	12297725

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IDA	8454642
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0030277	Process	Maintenance of gastrointestinal epithelium	IBA	21873635

MIM	HGNC	e!Ensembl
600633	11757	ENSG00000160180

Protein

UniProt ID

Q07654

Protein name

Trefoil factor 3 (Intestinal trefoil factor) (hITF) (Polypeptide P1.B) (hP1.B)

Protein function

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

PDB

1E9T , 1PE3 , 6V1C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00088	Trefoil	46 → 86	Trefoil (P-type) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricu

Sequence

MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPH
VTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Sequence length

Interactions

View interactions

	Reactome
			Estrogen-dependent gene expression

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	24863737

Show/Hide Text Mining Associations (98)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	28640195, 35891358
Adenocarcinoma	Associate	25997063, 34609407
Adenocarcinoma Follicular	Inhibit	15083192
Adenocarcinoma Mucinous	Associate	36690709
Adenocarcinoma of Lung	Associate	25997063
Adenoma	Associate	15083192, 22223087
Allergic Fungal Sinusitis	Associate	31683988
Arthritis Rheumatoid	Stimulate	31817054
Arthritis Rheumatoid	Associate	36973646
Asthma	Associate	33878997
Atrophy	Associate	29747491
Barrett Esophagus	Associate	10190312, 24550372, 25634542, 29084829, 29906417, 35437997, 35843173
Breast Neoplasms	Associate	12671691, 15845533, 20132413, 22341453, 24058517, 24297604, 30431719, 30457247, 30744593, 35216615
Breast Neoplasms	Stimulate	28687783
Carcinogenesis	Associate	16437709, 23329884, 24125969
Carcinoma Hepatocellular	Associate	30424721
Carcinoma in Situ	Associate	22341453
Carcinoma Medullary	Associate	24437456
Carcinoma Pancreatic Ductal	Stimulate	35332126
Cholangiocarcinoma	Associate	21472131
Clear cell metastatic renal cell carcinoma	Associate	24282531
Colitis Ulcerative	Associate	16924127, 23691218
Colorectal Neoplasms	Associate	24125969, 26307678, 28104986
Colorectal Neoplasms	Stimulate	27760866, 31432157
Colorectal Neoplasms	Inhibit	33210724
Crohn Disease	Associate	11358897, 23691218
Depressive Disorder Major	Stimulate	27232630
Diarrhea	Associate	29633639
Disease	Inhibit	12452845
Early Onset Glaucoma	Associate	23329884
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	18682706
Endometrial Neoplasms	Associate	18682706
Eosinophilic Esophagitis	Associate	35437997
Esophageal Squamous Cell Carcinoma	Associate	18219111
Fibrocystic Breast Disease	Stimulate	22341453
Fibrosis	Associate	29987860
Gastritis Atrophic	Stimulate	39234749
Gastroenteritis	Stimulate	24282531
Gastrointestinal Diseases	Associate	12377807
Glomerulonephritis IGA	Associate	29987860
Heart Failure	Stimulate	36184749
Heart Failure Diastolic	Associate	36184749
Hypoxia	Associate	23455892, 24927122
Immune System Diseases	Associate	24927122
Immunoglobulin Light chain Amyloidosis	Associate	32922167
Infertility	Associate	24228773
Infertility Female	Associate	24228773
Inflammation	Associate	24282531, 24927122
Inflammatory Bowel Diseases	Associate	28627600
Inflammatory Bowel Diseases	Inhibit	37299399
Intestinal Diseases	Associate	25800782, 28453457, 35843173
Irritable Bowel Syndrome	Stimulate	22998556
Irritable Bowel Syndrome	Associate	29633639
Kidney Diseases	Associate	33134397
Lung Diseases	Associate	40224201
Lung Neoplasms	Stimulate	22246423
Lung Neoplasms	Associate	25997063, 34761591
Lupus Erythematosus Systemic	Associate	33134397
Lymphatic Metastasis	Stimulate	23329884, 24125969, 24358147, 28104986
Macular Degeneration	Associate	32974084
Mucositis	Associate	28627600
Multiple Myeloma	Associate	32922167
Muscular Disorders Atrophic	Associate	29747491
Nasal Polyps	Associate	31683988
Neoplasm Invasiveness	Associate	22341453, 30744593
Neoplasm Metastasis	Inhibit	15083192
Neoplasm Metastasis	Associate	22341453
Neoplasms	Inhibit	12377807, 27626280, 31450568, 35833823
Neoplasms	Associate	15083192, 21170267, 22223087, 22341453, 23936147, 24125969, 24282531, 26780780, 26823779, 28104986, 30139961, 30431719, 30457247, 33210724, 39369842
Neoplasms	Stimulate	31432157
Neoplasms by Histologic Type	Associate	28470574
Nephritis Interstitial	Associate	29987860
Obesity Maternal	Inhibit	36189989
Osteoarthritis	Associate	31817054
Ovarian Neoplasms	Associate	21131918, 26780780, 28470574
Pancreatic Intraductal Neoplasms	Associate	12000726
Pancreatic Neoplasms	Associate	35332126
Papilloma	Stimulate	22341453
Pituitary Neoplasms	Associate	26823779, 35833823
Prostatic Neoplasms	Stimulate	15368473, 28930171
Prostatic Neoplasms	Associate	21170267, 24043589, 25639219, 30139961, 34609407, 38256434
Prostatitis	Associate	15368473, 30139961
Pulmonary Disease Chronic Obstructive	Associate	40224201
Renal Insufficiency Chronic	Stimulate	24282531
Renal Insufficiency Chronic	Associate	29987860
Reticular dysgenesis	Associate	32974084
Retinoblastoma	Inhibit	25199519, 27626280, 31450568
Sleep Apnea Obstructive	Associate	29028798
Smoke Inhalation Injury	Stimulate	17727719
Stomach Neoplasms	Associate	16437709, 18593995, 18938748, 21487519, 23329884, 24358147, 24927122, 25514872, 26240479, 28453457, 29747491
Tertiary Lymphoid Structures	Associate	22341453
Tertiary Lymphoid Structures	Stimulate	30431719, 30457247
Thrombosis	Associate	36696180
Thyroid Cancer Papillary	Associate	36465624
Thyroid Neoplasms	Associate	22223087
Thyroid Nodule	Associate	22572548
Triple Negative Breast Neoplasms	Associate	36157217
Uterine Cervical Neoplasms	Associate	39346086

TFF3 (trefoil factor 3)