TFF3 (trefoil factor 3)

Gene

• Entrez ID: 7033
• Gene name: Trefoil factor 3
• Gene symbol: TFF3
• Synonyms (NCBI Gene): ITF, P1B, TFI
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1420576	hsa-miR-1254	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420583	hsa-miR-3116	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT1420591	hsa-miR-4705	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT1420596	hsa-miR-515-3p	CLIP-seq
MIRT1420597	hsa-miR-519e	CLIP-seq
MIRT1420598	hsa-miR-550a	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420602	hsa-miR-885-3p	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT2126311	hsa-miR-1285	CLIP-seq
MIRT2126312	hsa-miR-1304	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT2126313	hsa-miR-3187-5p	CLIP-seq
MIRT2126314	hsa-miR-320a	CLIP-seq
MIRT2126315	hsa-miR-320b	CLIP-seq
MIRT2126316	hsa-miR-320c	CLIP-seq
MIRT2126317	hsa-miR-320d	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT2126318	hsa-miR-4328	CLIP-seq
MIRT2126319	hsa-miR-4429	CLIP-seq
MIRT2126320	hsa-miR-4475	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT2126321	hsa-miR-4771	CLIP-seq
MIRT2126322	hsa-miR-4780	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT2126323	hsa-miR-518e	CLIP-seq
MIRT2126324	hsa-miR-612	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT2126325	hsa-miR-7	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq
MIRT2126326	hsa-miR-938	CLIP-seq
MIRT2348302	hsa-miR-1207-3p	CLIP-seq
MIRT1420576	hsa-miR-1254	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT2348303	hsa-miR-1273g	CLIP-seq
MIRT2348304	hsa-miR-140-5p	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420583	hsa-miR-3116	CLIP-seq
MIRT2348305	hsa-miR-3135b	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT2126314	hsa-miR-320a	CLIP-seq
MIRT2126315	hsa-miR-320b	CLIP-seq
MIRT2126316	hsa-miR-320c	CLIP-seq
MIRT2126317	hsa-miR-320d	CLIP-seq
MIRT2348306	hsa-miR-323b-5p	CLIP-seq
MIRT2348307	hsa-miR-324-5p	CLIP-seq
MIRT2348308	hsa-miR-3611	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT2348309	hsa-miR-3689d	CLIP-seq
MIRT2348310	hsa-miR-3907	CLIP-seq
MIRT2348311	hsa-miR-3909	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT2126318	hsa-miR-4328	CLIP-seq
MIRT2126319	hsa-miR-4429	CLIP-seq
MIRT2126320	hsa-miR-4475	CLIP-seq
MIRT2348312	hsa-miR-4511	CLIP-seq
MIRT2348313	hsa-miR-4693-3p	CLIP-seq
MIRT1420591	hsa-miR-4705	CLIP-seq
MIRT2348314	hsa-miR-4707-5p	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT2348315	hsa-miR-486-3p	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT1420596	hsa-miR-515-3p	CLIP-seq
MIRT2126323	hsa-miR-518e	CLIP-seq
MIRT1420597	hsa-miR-519e	CLIP-seq
MIRT1420598	hsa-miR-550a	CLIP-seq
MIRT2348316	hsa-miR-615-3p	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT2126325	hsa-miR-7	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420602	hsa-miR-885-3p	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	17182120
CEBPB	Unknown	12297725
ERG	Unknown	21170267
NFKB1	Activation	12912861
NFKB1	Unknown	12297725
RELA	Activation	12912861
RELA	Unknown	12297725

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20423149, 25416956, 31658587, 32296183
GO:0005576	Component	Extracellular region	IDA	8454642
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030277	Process	Maintenance of gastrointestinal epithelium	IBA
GO:0042802	Function	Identical protein binding	IPI	20423149, 31658587

Other IDs

• MIM: 600633
• HGNC: 11757
• e!Ensembl: ENSG00000160180

Protein

• UniProt ID: Q07654
• Protein name: Trefoil factor 3 (Intestinal trefoil factor) (hITF) (Polypeptide P1.B) (hP1.B)
• Protein function: Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
• PDB: 1E9T, 1PE3, 6V1C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00088	Trefoil	46 → 86	Trefoil (P-type) domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricu
• Sequence:

  MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPH
  VTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

• Sequence length: 94

Pathways

Reactome:

Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, ANIMAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acute Kidney Injury	Associate	28640195, 35891358	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	25997063, 34609407	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Follicular	Inhibit	15083192	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Mucinous	Associate	36690709	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	25997063	★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	15083192, 22223087	★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Associate	31683988	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	31817054	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	36973646	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	33878997	★☆☆☆☆ Found in Text Mining only
Atrophy	Associate	29747491	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Associate	10190312, 24550372, 25634542, 29084829, 29906417, 35437997, 35843173	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	12671691, 15845533, 20132413, 22341453, 24058517, 24297604, 30431719, 30457247, 30744593, 35216615	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	28687783	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	16437709, 23329884, 24125969	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30424721	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Associate	22341453	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Associate	24437456	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Stimulate	35332126	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	21472131	★☆☆☆☆ Found in Text Mining only
Clear cell metastatic renal cell carcinoma	Associate	24282531	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	16924127, 23691218	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24125969, 26307678, 28104986	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	27760866, 31432157	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	33210724	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	11358897, 23691218	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Stimulate	27232630	★☆☆☆☆ Found in Text Mining only
Diarrhea	Associate	29633639	★☆☆☆☆ Found in Text Mining only
Disease	Inhibit	12452845	★☆☆☆☆ Found in Text Mining only
Early Onset Glaucoma	Associate	23329884	★☆☆☆☆ Found in Text Mining only
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	18682706	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	18682706	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	35437997	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	18219111	★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Stimulate	22341453	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	29987860	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Stimulate	39234749	★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Stimulate	24282531	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Associate	12377807	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Associate	29987860	★☆☆☆☆ Found in Text Mining only
Heart Failure	Stimulate	36184749	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Associate	36184749	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	23455892, 24927122	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Associate	24927122	★☆☆☆☆ Found in Text Mining only
Immunoglobulin Light chain Amyloidosis	Associate	32922167	★☆☆☆☆ Found in Text Mining only
Infertility	Associate	24228773	★☆☆☆☆ Found in Text Mining only
Infertility Female	Associate	24228773	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	24282531, 24927122	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	28627600	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inhibit	37299399	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Associate	25800782, 28453457, 35843173	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Stimulate	22998556	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Associate	29633639	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	33134397	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Associate	40224201	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	22246423	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	25997063, 34761591	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	33134397	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	23329884, 24125969, 24358147, 28104986	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Associate	32974084	★☆☆☆☆ Found in Text Mining only
Mucositis	Associate	28627600	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Associate	32922167	★☆☆☆☆ Found in Text Mining only
Muscular Disorders Atrophic	Associate	29747491	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	31683988	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	22341453, 30744593	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	15083192	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22341453	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	12377807, 27626280, 31450568, 35833823	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	15083192, 21170267, 22223087, 22341453, 23936147, 24125969, 24282531, 26780780, 26823779, 28104986, 30139961, 30431719, 30457247, 33210724, 39369842	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	31432157	★☆☆☆☆ Found in Text Mining only
Neoplasms by Histologic Type	Associate	28470574	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Associate	29987860	★☆☆☆☆ Found in Text Mining only
Obesity Maternal	Inhibit	36189989	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	31817054	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	21131918, 26780780, 28470574	★☆☆☆☆ Found in Text Mining only
Pancreatic Intraductal Neoplasms	Associate	12000726	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	35332126	★☆☆☆☆ Found in Text Mining only
Papilloma	Stimulate	22341453	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Associate	26823779, 35833823	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	15368473, 28930171	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	21170267, 24043589, 25639219, 30139961, 34609407, 38256434	★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	15368473, 30139961	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	40224201	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Stimulate	24282531	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Associate	29987860	★☆☆☆☆ Found in Text Mining only
Reticular dysgenesis	Associate	32974084	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Inhibit	25199519, 27626280, 31450568	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Associate	29028798	★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Stimulate	17727719	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	16437709, 18593995, 18938748, 21487519, 23329884, 24358147, 24927122, 25514872, 26240479, 28453457, 29747491	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	22341453	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Stimulate	30431719, 30457247	★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	36696180	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	36465624	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	22223087	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Associate	22572548	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	36157217	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	39346086	★☆☆☆☆ Found in Text Mining only