Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7016
Gene name Gene Name - the full gene name approved by the HGNC.	Testis associated actin remodelling kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TESK1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases (LIMKs).

Show/Hide all(66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029271	hsa-miR-26b-5p	Microarray	19088304
MIRT049152	hsa-miR-92a-3p	CLASH	23622248
MIRT049152	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT107664	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT107661	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1418474	hsa-miR-1203	CLIP-seq
MIRT1418475	hsa-miR-1231	CLIP-seq
MIRT1418476	hsa-miR-1538	CLIP-seq
MIRT1418477	hsa-miR-203	CLIP-seq
MIRT1418478	hsa-miR-25	CLIP-seq
MIRT1418479	hsa-miR-2682	CLIP-seq
MIRT1418480	hsa-miR-302f	CLIP-seq
MIRT1418481	hsa-miR-3152-3p	CLIP-seq
MIRT1418482	hsa-miR-3194-5p	CLIP-seq
MIRT1418483	hsa-miR-32	CLIP-seq
MIRT1418484	hsa-miR-3607-5p	CLIP-seq
MIRT1418485	hsa-miR-363	CLIP-seq
MIRT1418486	hsa-miR-367	CLIP-seq
MIRT1418487	hsa-miR-3908	CLIP-seq
MIRT1418488	hsa-miR-4283	CLIP-seq
MIRT1418489	hsa-miR-4328	CLIP-seq
MIRT1418490	hsa-miR-4474-5p	CLIP-seq
MIRT1418491	hsa-miR-4489	CLIP-seq
MIRT1418492	hsa-miR-449c	CLIP-seq
MIRT1418493	hsa-miR-4514	CLIP-seq
MIRT1418494	hsa-miR-4645-5p	CLIP-seq
MIRT1418495	hsa-miR-4673	CLIP-seq
MIRT1418496	hsa-miR-4692	CLIP-seq
MIRT1418497	hsa-miR-4711-3p	CLIP-seq
MIRT1418498	hsa-miR-4731-5p	CLIP-seq
MIRT1418499	hsa-miR-4745-3p	CLIP-seq
MIRT1418500	hsa-miR-4755-3p	CLIP-seq
MIRT1418501	hsa-miR-4780	CLIP-seq
MIRT1418502	hsa-miR-545	CLIP-seq
MIRT1418503	hsa-miR-592	CLIP-seq
MIRT1418504	hsa-miR-597	CLIP-seq
MIRT1418505	hsa-miR-602	CLIP-seq
MIRT1418506	hsa-miR-623	CLIP-seq
MIRT1418507	hsa-miR-627	CLIP-seq
MIRT1418508	hsa-miR-92a	CLIP-seq
MIRT1418509	hsa-miR-92b	CLIP-seq
MIRT2125518	hsa-miR-1253	CLIP-seq
MIRT2125519	hsa-miR-3175	CLIP-seq
MIRT1418488	hsa-miR-4283	CLIP-seq
MIRT2125520	hsa-miR-4434	CLIP-seq
MIRT1418491	hsa-miR-4489	CLIP-seq
MIRT2125521	hsa-miR-4516	CLIP-seq
MIRT1418498	hsa-miR-4731-5p	CLIP-seq
MIRT1418501	hsa-miR-4780	CLIP-seq
MIRT1418505	hsa-miR-602	CLIP-seq
MIRT1418506	hsa-miR-623	CLIP-seq
MIRT1418507	hsa-miR-627	CLIP-seq
MIRT2640710	hsa-miR-198	CLIP-seq
MIRT2640711	hsa-miR-2116	CLIP-seq
MIRT2640712	hsa-miR-3140-5p	CLIP-seq
MIRT2640713	hsa-miR-3194-3p	CLIP-seq
MIRT2640714	hsa-miR-338-3p	CLIP-seq
MIRT2640715	hsa-miR-3926	CLIP-seq
MIRT2640716	hsa-miR-4493	CLIP-seq
MIRT2640717	hsa-miR-4530	CLIP-seq
MIRT2640718	hsa-miR-4677-5p	CLIP-seq
MIRT2640719	hsa-miR-4753-5p	CLIP-seq
MIRT2640720	hsa-miR-5095	CLIP-seq
MIRT2640721	hsa-miR-595	CLIP-seq
MIRT2640722	hsa-miR-600	CLIP-seq
MIRT2640723	hsa-miR-648	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	25849865
GO:0004672	Function	Protein kinase activity	IMP	15584898
GO:0004672	Function	Protein kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12027893, 15584898
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	15584898
GO:0005813	Component	Centrosome	IDA	25849865
GO:0005829	Component	Cytosol	TAS
GO:0007283	Process	Spermatogenesis	IEA
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA	21873635
GO:0031410	Component	Cytoplasmic vesicle	ISS	18216281
GO:0031953	Process	Negative regulation of protein autophosphorylation	ISS	18216281
GO:0032880	Process	Regulation of protein localization	ISS	18216281
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0042326	Process	Negative regulation of phosphorylation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051496	Process	Positive regulation of stress fiber assembly	IBA	21873635
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS	18216281
GO:0051496	Process	Positive regulation of stress fiber assembly	TAS	18216281
GO:0051650	Process	Establishment of vesicle localization	IMP	25849865
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	ISS	18216281
GO:0090521	Process	Glomerular visceral epithelial cell migration	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	15584898
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	25849865
GO:1902018	Process	Negative regulation of cilium assembly	IMP	25849865

MIM	HGNC	e!Ensembl
601782	11731	ENSG00000107140

Protein

UniProt ID

Q15569

Protein name

Dual specificity testis-specific protein kinase 1 (EC 2.7.12.1) (Testicular protein kinase 1)

Protein function

Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues (By similarity). Regulates the cellular cytoskeleton by enhancing actin stress fib

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	57 → 311	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in podocytes and renal tubular cells in the kidney (at protein level). {ECO:0000269|PubMed:30115939}.

Sequence

MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKN
CLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPST
RAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHS
LPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCE
AGSLLCHRGHHAKPPTPSLQLPGARS

Sequence length

626

Interactions

View interactions

	Reactome
			Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Intestinal Diseases	Associate	29396473
Irritable Bowel Syndrome	Inhibit	29396473
Neoplasms Glandular and Epithelial	Associate	29396473

TESK1 (testis associated actin remodelling kinase 1)