Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7016
Gene name	Testis associated actin remodelling kinase 1
Gene symbol	TESK1
Synonyms (NCBI Gene)	-
Chromosome	9
Chromosome location	9p13.3
Summary	This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases (LIMKs).

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029271	hsa-miR-26b-5p	Microarray	19088304
MIRT049152	hsa-miR-92a-3p	CLASH	23622248
MIRT049152	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT107664	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT107661	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1418474	hsa-miR-1203	CLIP-seq
MIRT1418475	hsa-miR-1231	CLIP-seq
MIRT1418476	hsa-miR-1538	CLIP-seq
MIRT1418477	hsa-miR-203	CLIP-seq
MIRT1418478	hsa-miR-25	CLIP-seq
MIRT1418479	hsa-miR-2682	CLIP-seq
MIRT1418480	hsa-miR-302f	CLIP-seq
MIRT1418481	hsa-miR-3152-3p	CLIP-seq
MIRT1418482	hsa-miR-3194-5p	CLIP-seq
MIRT1418483	hsa-miR-32	CLIP-seq
MIRT1418484	hsa-miR-3607-5p	CLIP-seq
MIRT1418485	hsa-miR-363	CLIP-seq
MIRT1418486	hsa-miR-367	CLIP-seq
MIRT1418487	hsa-miR-3908	CLIP-seq
MIRT1418488	hsa-miR-4283	CLIP-seq
MIRT1418489	hsa-miR-4328	CLIP-seq
MIRT1418490	hsa-miR-4474-5p	CLIP-seq
MIRT1418491	hsa-miR-4489	CLIP-seq
MIRT1418492	hsa-miR-449c	CLIP-seq
MIRT1418493	hsa-miR-4514	CLIP-seq
MIRT1418494	hsa-miR-4645-5p	CLIP-seq
MIRT1418495	hsa-miR-4673	CLIP-seq
MIRT1418496	hsa-miR-4692	CLIP-seq
MIRT1418497	hsa-miR-4711-3p	CLIP-seq
MIRT1418498	hsa-miR-4731-5p	CLIP-seq
MIRT1418499	hsa-miR-4745-3p	CLIP-seq
MIRT1418500	hsa-miR-4755-3p	CLIP-seq
MIRT1418501	hsa-miR-4780	CLIP-seq
MIRT1418502	hsa-miR-545	CLIP-seq
MIRT1418503	hsa-miR-592	CLIP-seq
MIRT1418504	hsa-miR-597	CLIP-seq
MIRT1418505	hsa-miR-602	CLIP-seq
MIRT1418506	hsa-miR-623	CLIP-seq
MIRT1418507	hsa-miR-627	CLIP-seq
MIRT1418508	hsa-miR-92a	CLIP-seq
MIRT1418509	hsa-miR-92b	CLIP-seq
MIRT2125518	hsa-miR-1253	CLIP-seq
MIRT2125519	hsa-miR-3175	CLIP-seq
MIRT1418488	hsa-miR-4283	CLIP-seq
MIRT2125520	hsa-miR-4434	CLIP-seq
MIRT1418491	hsa-miR-4489	CLIP-seq
MIRT2125521	hsa-miR-4516	CLIP-seq
MIRT1418498	hsa-miR-4731-5p	CLIP-seq
MIRT1418501	hsa-miR-4780	CLIP-seq
MIRT1418505	hsa-miR-602	CLIP-seq
MIRT1418506	hsa-miR-623	CLIP-seq
MIRT1418507	hsa-miR-627	CLIP-seq
MIRT2640710	hsa-miR-198	CLIP-seq
MIRT2640711	hsa-miR-2116	CLIP-seq
MIRT2640712	hsa-miR-3140-5p	CLIP-seq
MIRT2640713	hsa-miR-3194-3p	CLIP-seq
MIRT2640714	hsa-miR-338-3p	CLIP-seq
MIRT2640715	hsa-miR-3926	CLIP-seq
MIRT2640716	hsa-miR-4493	CLIP-seq
MIRT2640717	hsa-miR-4530	CLIP-seq
MIRT2640718	hsa-miR-4677-5p	CLIP-seq
MIRT2640719	hsa-miR-4753-5p	CLIP-seq
MIRT2640720	hsa-miR-5095	CLIP-seq
MIRT2640721	hsa-miR-595	CLIP-seq
MIRT2640722	hsa-miR-600	CLIP-seq
MIRT2640723	hsa-miR-648	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	15584898
GO:0004672	Function	Protein kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8537404
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12027893, 15584898, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15584898
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	25849865
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	TAS	8537404
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IEA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	ISS	18216281
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS	18216281
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032880	Process	Regulation of protein localization	ISS	18216281
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051496	Process	Positive regulation of stress fiber assembly	IBA
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS	18216281
GO:0051496	Process	Positive regulation of stress fiber assembly	TAS	18216281
GO:0051650	Process	Establishment of vesicle localization	IMP	25849865
GO:0070966	Process	Nuclear-transcribed mRNA catabolic process, no-go decay	IEA
GO:0070966	Process	Nuclear-transcribed mRNA catabolic process, no-go decay	ISS
GO:0090521	Process	Podocyte cell migration	IEA
GO:0090521	Process	Podocyte cell migration	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	15584898
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	25849865
GO:1902018	Process	Negative regulation of cilium assembly	IMP	25849865

MIM	HGNC	e!Ensembl
601782	11731	ENSG00000107140

Q15569

Protein name

Dual specificity testis-specific protein kinase 1 (EC 2.7.12.1) (Testicular protein kinase 1)

Protein function

Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues (By similarity). Regulates the cellular cytoskeleton by enhancing actin stress fib

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	57 → 311	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in podocytes and renal tubular cells in the kidney (at protein level). {ECO:0000269|PubMed:30115939}.

Sequence

MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKN
CLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPST
RAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHS
LPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCE
AGSLLCHRGHHAKPPTPSLQLPGARS

Sequence length

626

Interactions

View interactions

	Reactome
			Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Intestinal Diseases	Associate	29396473	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Inhibit	29396473	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Glandular and Epithelial	Associate	29396473	★★★★★ ★☆☆☆☆ Found in Text Mining only

TESK1 (testis associated actin remodelling kinase 1)