Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6999
Gene name Gene Name - the full gene name approved by the HGNC.	Tryptophan 2,3-dioxygenase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TDO2
Synonyms (NCBI Gene) Gene synonyms aliases	HYPTRP, TDO, TO, TPH2, TRPO
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a ro

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs767123432	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1553957997	G>C	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments
MIRT2347492	hsa-miR-4272	CLIP-seq
MIRT2347493	hsa-miR-4719	CLIP-seq
MIRT2347494	hsa-miR-4742-3p	CLIP-seq
MIRT2347495	hsa-miR-548g	CLIP-seq
MIRT2640430	hsa-miR-1245	CLIP-seq
MIRT2640431	hsa-miR-1264	CLIP-seq
MIRT2640432	hsa-miR-1266	CLIP-seq
MIRT2640433	hsa-miR-140-5p	CLIP-seq
MIRT2640434	hsa-miR-155	CLIP-seq
MIRT2640435	hsa-miR-3166	CLIP-seq
MIRT2640436	hsa-miR-323-3p	CLIP-seq
MIRT2640437	hsa-miR-338-5p	CLIP-seq
MIRT2640438	hsa-miR-3647-3p	CLIP-seq
MIRT2640439	hsa-miR-3655	CLIP-seq
MIRT2640440	hsa-miR-3664-3p	CLIP-seq
MIRT2640441	hsa-miR-3678-3p	CLIP-seq
MIRT2640442	hsa-miR-376a	CLIP-seq
MIRT2640443	hsa-miR-376b	CLIP-seq
MIRT2640444	hsa-miR-3907	CLIP-seq
MIRT2640445	hsa-miR-409-5p	CLIP-seq
MIRT2347492	hsa-miR-4272	CLIP-seq
MIRT2640446	hsa-miR-4474-5p	CLIP-seq
MIRT2640447	hsa-miR-450b-5p	CLIP-seq
MIRT2640448	hsa-miR-4518	CLIP-seq
MIRT2640449	hsa-miR-4668-3p	CLIP-seq
MIRT2347493	hsa-miR-4719	CLIP-seq
MIRT2347494	hsa-miR-4742-3p	CLIP-seq
MIRT2640450	hsa-miR-4771	CLIP-seq
MIRT2640451	hsa-miR-4777-5p	CLIP-seq
MIRT2640452	hsa-miR-494	CLIP-seq
MIRT2640453	hsa-miR-507	CLIP-seq
MIRT2640454	hsa-miR-518d-5p	CLIP-seq
MIRT2640455	hsa-miR-519b-5p	CLIP-seq
MIRT2640456	hsa-miR-519c-5p	CLIP-seq
MIRT2640457	hsa-miR-520c-5p	CLIP-seq
MIRT2640458	hsa-miR-526a	CLIP-seq
MIRT2347495	hsa-miR-548g	CLIP-seq
MIRT2640459	hsa-miR-557	CLIP-seq
MIRT2640460	hsa-miR-586	CLIP-seq
MIRT2640461	hsa-miR-630	CLIP-seq
MIRT2640435	hsa-miR-3166	CLIP-seq
MIRT2640437	hsa-miR-338-5p	CLIP-seq
MIRT2640438	hsa-miR-3647-3p	CLIP-seq
MIRT2640441	hsa-miR-3678-3p	CLIP-seq
MIRT2640442	hsa-miR-376a	CLIP-seq
MIRT2640443	hsa-miR-376b	CLIP-seq
MIRT2640444	hsa-miR-3907	CLIP-seq
MIRT2692861	hsa-miR-3929	CLIP-seq
MIRT2347492	hsa-miR-4272	CLIP-seq
MIRT2692862	hsa-miR-4419b	CLIP-seq
MIRT2692863	hsa-miR-4478	CLIP-seq
MIRT2640447	hsa-miR-450b-5p	CLIP-seq
MIRT2640449	hsa-miR-4668-3p	CLIP-seq
MIRT2347493	hsa-miR-4719	CLIP-seq
MIRT2347494	hsa-miR-4742-3p	CLIP-seq
MIRT2640450	hsa-miR-4771	CLIP-seq
MIRT2640451	hsa-miR-4777-5p	CLIP-seq
MIRT2640453	hsa-miR-507	CLIP-seq
MIRT2640454	hsa-miR-518d-5p	CLIP-seq
MIRT2640455	hsa-miR-519b-5p	CLIP-seq
MIRT2640456	hsa-miR-519c-5p	CLIP-seq
MIRT2640457	hsa-miR-520c-5p	CLIP-seq
MIRT2640458	hsa-miR-526a	CLIP-seq
MIRT2347495	hsa-miR-548g	CLIP-seq
MIRT2640459	hsa-miR-557	CLIP-seq
MIRT2640460	hsa-miR-586	CLIP-seq
MIRT2640461	hsa-miR-630	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
YY1	Unknown	10580097

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IBA
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IDA	27762317, 28285122
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IEA
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	TAS	8666386
GO:0005515	Function	Protein binding	IPI	16189514, 24722188, 25416956, 25910212, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005829	Component	Cytosol	TAS
GO:0006568	Process	L-tryptophan metabolic process	IEA
GO:0006569	Process	L-tryptophan catabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016597	Function	Amino acid binding	IEA
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	IDA	27762317
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	IEA
GO:0019442	Process	L-tryptophan catabolic process to acetyl-CoA	IBA
GO:0019442	Process	L-tryptophan catabolic process to acetyl-CoA	IEA
GO:0019825	Function	Oxygen binding	IEA
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IDA	27762317, 28285122
GO:0020037	Function	Heme binding	IEA
GO:0042802	Function	Identical protein binding	IPI	24722188, 25416956, 32296183
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051289	Process	Protein homotetramerization	IDA	27762317, 28285122
GO:1904842	Process	Response to nitroglycerin	IEA

MIM	HGNC	e!Ensembl
191070	11708	ENSG00000151790

Protein

UniProt ID

P48775

Protein name

Tryptophan 2,3-dioxygenase (TDO) (EC 1.13.11.11) (Tryptamin 2,3-dioxygenase) (Tryptophan oxygenase) (TO) (TRPO) (Tryptophan pyrrolase) (Tryptophanase)

Protein function

Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety. {ECO:0000255|HAMAP-Rule:MF_03020

PDB

4PW8 , 5TI9 , 5TIA , 6A4I , 6PYY , 6PYZ , 6UD5 , 6VBN , 7LU7 , 7UI3 , 8QV7 , 8R5Q , 8R5R , 8VTQ , 8VUG , 8VZV , 8W1H , 8W2K , 9AT2 , 9B17 , 9B1Q , 9EZJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03301	Trp_dioxygenase	26 → 372	Tryptophan 2,3-dioxygenase	Family

Sequence

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Sequence length

406

Interactions

View interactions

	KEGG		Reactome
	Tryptophan metabolism Metabolic pathways Biosynthesis of cofactors		Tryptophan catabolism

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hypertryptophanemia	familial hypertryptophanemia	rs767123432, rs1553957997	N/A

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37985999
Adenomatous Polyposis Coli	Stimulate	35537038
Adjustment Disorders	Stimulate	25540092
Breast Neoplasms	Associate	27573671, 30143553
Carcinoma Basal Cell	Associate	29938775
Carcinoma Hepatocellular	Associate	32532962, 34557456
Carcinoma Renal Cell	Associate	33410234, 34174844, 36216827
Carcinoma Renal Cell	Stimulate	38183155
Clear cell metastatic renal cell carcinoma	Associate	33410234
Colorectal Neoplasms	Associate	27578919, 35537038
COVID 19	Inhibit	36690820
Esophagitis	Inhibit	12528120
Fibrosis	Associate	39774873
GATA2 Deficiency	Associate	37148546
Genetic Diseases Inborn	Associate	20042375
Glioblastoma	Associate	26651356, 31866995, 32117235, 32477324
Glioma	Associate	32477324
Hypertension Pulmonary	Stimulate	12528120
Hypertension Pulmonary	Associate	37786941
Hypertryptophanemia Familial	Associate	28285122
Hypoxia	Inhibit	31866995
Hypoxia Brain	Inhibit	31866995
Infections	Associate	23821371
Inflammation	Stimulate	30213797
Inflammation	Associate	35733134
Inflammatory Bowel Diseases	Associate	34948292
Leiomyoma	Associate	34116832, 35715314, 36375056, 37607000
Lung Diseases Interstitial	Stimulate	12528120
Lymphoma Large B Cell Diffuse	Associate	32481253
Melanoma	Associate	32776284
Meningioma	Associate	26092774
Neoplasm Metastasis	Associate	24485798, 30143553, 38552852
Neoplasms	Associate	25415278, 25881064, 26092774, 27573671, 28027300, 29667084, 29938775, 30420594, 31802183, 32117235, 32477324, 32481253, 32776284, 33410234, 33846800 View all (8 more)
Nevus	Associate	37123046
Osteoarthritis	Associate	35733134
Ovarian Neoplasms	Stimulate	33846800
Ovarian Neoplasms	Associate	38062922
Papillomavirus Infections	Associate	31412167
Prostatic Neoplasms	Associate	28027300
Pulmonary Arterial Hypertension	Associate	37786941
Rectal Neoplasms	Associate	18229684, 22171132
Rupture	Associate	38062922
Scleroderma Diffuse	Associate	12528120
Scleroderma Systemic	Stimulate	12528120
Serotonin Syndrome	Associate	32270230
Squamous Intraepithelial Lesions	Associate	31412167
Stomach Neoplasms	Associate	36430322
Testicular Germ Cell Tumor	Associate	36118672
Triple Negative Breast Neoplasms	Associate	30143553
Triple Negative Breast Neoplasms	Stimulate	30213797
Urinary Bladder Neoplasms	Associate	34101386
Urinary Bladder Neoplasms	Stimulate	38552852
Uterine Cervical Neoplasms	Associate	31412167
Uterine Cervicitis	Associate	31412167
Vascular System Injuries	Inhibit	12528120

TDO2 (tryptophan 2,3-dioxygenase)