TRB (T cell receptor beta locus)

Gene
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6957
Gene name Gene Name - the full gene name approved by the HGNC.
T cell receptor beta locus
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRB
Synonyms (NCBI Gene) Gene synonyms aliases
TCRB, TRB@
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q34
Summary Summary of gene provided in NCBI Entrez Gene.
T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
ETS1 Repression 1409722
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0002355 Process Detection of tumor cell IDA 31959982
GO:0002419 Process T cell mediated cytotoxicity directed against tumor cell target IDA 31959982
GO:0016021 Component Integral component of membrane IEA
GO:0038023 Function Signaling receptor activity IDA 31959982
GO:0042105 Component Alpha-beta T cell receptor complex IDA 31959982
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC 12155 N/A
Protein
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P0DSE2
Protein name M1-specific T cell receptor beta chain (TR beta chain TRBV19*01J2S7*01C*02)
Protein function The beta chain of TRAV27*01J42*01C*01/TRBV19*01J2S7*01C*02 alpha-beta T cell receptor (TR) clonotype that is specific for HLA-A*02:01-restricted M/matrix protein 1 immunodominant epitope GILGFVFTL of influenza A virus (IAV). Classified as a publ
PDB 1OGA , 2VLJ , 2VLK , 2VLR , 5HHM , 5HHO , 6JXR , 7FJD , 7FJE , 7FJF
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in M/matrix protein 1-specific effector memory CD8-positive T cells readily detectable in the peripheral blood, secondary lymphoid organs and lung (primary site of infection) of IAV infected individuals. {ECO:0000269|PubMed:2
Sequence 
MSNQVLCCVVLCLLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQ
GLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQ
YFGPGTRLTVTEDLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNG
KEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEW
TQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLM
AMVKRKDSRG
Sequence length 310
UniProt ID P0DTU4
Protein name T cell receptor beta chain MC.7.G5 (TR beta chain TRBV25-1*01J2S3*01C2*01) (MC.7.G5 TRB)
Protein function The beta chain of TRAV38-2DV8*01J31*01C*01/TRBV25-1*01J2S3*01C2*01 alpha-beta T cell receptor (TR) clonotype that displays pan-cancer cell recognition via the invariant MR1 molecule. On CD8-positive T cell clone MC.7.G5, likely recognizes tumor-
PDB 8T4Z , 8TW4 , 8Y6X , 8YIV , 8YJ2 , 8YJ3 , 9C3E
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in MR1-restricted CD8-positive T cells. {ECO:0000269|PubMed:31959982}.
Sequence 
MTIRLLCYMGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGM
ELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSEARGLAE
FTDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELS
WWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLS
ENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVS
ALVLMAMVKRKDSRG
Sequence length 315
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lymphoblastic leukemia Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor T-cell acute lymphoblastic leukemia rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)
Show/Hide Text Mining Associations (121)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 32460698
Antiphospholipid Syndrome Associate 11895785
Arteriosclerosis Associate 17404318
Arthritis Psoriatic Associate 28835222, 31677365
Arthritis Rheumatoid Associate 10460187, 1352153, 1386608, 9741318
Ataxia Telangiectasia Associate 2529926
Autoimmune Diseases Associate 37604642, 7717407
Autoimmune Lymphoproliferative Syndrome Associate 19176318
Axial Spondyloarthritis Associate 30029674
Breast Neoplasms Associate 16282247, 23292282, 27452728, 34534367