Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6950
Gene name	T-complex 1
Gene symbol	TCP1
Synonyms (NCBI Gene)	CCT-alphaCCT1CCTaD6S230EIDDPMGSTCP-1-alpha
Chromosome	6
Chromosome location	6q25.3
Summary	The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051234	hsa-miR-16-5p	CLASH	23622248
MIRT050683	hsa-miR-18a-5p	CLASH	23622248
MIRT050084	hsa-miR-26a-5p	CLASH	23622248
MIRT048447	hsa-miR-100-5p	CLASH	23622248
MIRT046434	hsa-miR-15b-5p	CLASH	23622248
MIRT046287	hsa-miR-23b-3p	CLASH	23622248
MIRT045307	hsa-miR-186-5p	CLASH	23622248
MIRT044438	hsa-miR-320a	CLASH	23622248
MIRT043872	hsa-miR-378a-3p	CLASH	23622248
MIRT043731	hsa-miR-342-3p	CLASH	23622248
MIRT043392	hsa-miR-331-3p	CLASH	23622248
MIRT039658	hsa-miR-615-3p	CLASH	23622248
MIRT039658	hsa-miR-615-3p	CLASH	23622248
MIRT039480	hsa-miR-652-3p	CLASH	23622248
MIRT732981	hsa-miR-34a-3p	Immunohistochemistry (IHC)Western blotting	33500737
MIRT1416722	hsa-miR-200b	CLIP-seq
MIRT1416723	hsa-miR-200c	CLIP-seq
MIRT1416724	hsa-miR-2054	CLIP-seq
MIRT1416725	hsa-miR-3143	CLIP-seq
MIRT1416726	hsa-miR-33a	CLIP-seq
MIRT1416727	hsa-miR-33b	CLIP-seq
MIRT1416728	hsa-miR-429	CLIP-seq
MIRT1416729	hsa-miR-4761-5p	CLIP-seq
MIRT1416730	hsa-miR-543	CLIP-seq
MIRT1416731	hsa-miR-888	CLIP-seq
MIRT1416722	hsa-miR-200b	CLIP-seq
MIRT1416723	hsa-miR-200c	CLIP-seq
MIRT1416724	hsa-miR-2054	CLIP-seq
MIRT1416725	hsa-miR-3143	CLIP-seq
MIRT1416726	hsa-miR-33a	CLIP-seq
MIRT1416727	hsa-miR-33b	CLIP-seq
MIRT2124963	hsa-miR-340	CLIP-seq
MIRT1416728	hsa-miR-429	CLIP-seq
MIRT1416729	hsa-miR-4761-5p	CLIP-seq
MIRT1416730	hsa-miR-543	CLIP-seq
MIRT1416731	hsa-miR-888	CLIP-seq
MIRT2347440	hsa-miR-3973	CLIP-seq
MIRT2347441	hsa-miR-4257	CLIP-seq
MIRT2347442	hsa-miR-4501	CLIP-seq
MIRT2347443	hsa-miR-4751	CLIP-seq
MIRT2347444	hsa-miR-548k	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000242	Component	Pericentriolar material	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	14532270, 16085932, 16097032, 21098288, 24846140, 25416956, 25467444, 29477555, 30021884, 31470122, 32814053, 33144677, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005813	Component	Centrosome	IDA	20080638
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	1630491
GO:0005832	Component	Chaperonin-containing T-complex	IBA
GO:0005832	Component	Chaperonin-containing T-complex	IDA	23011926, 25467444, 30955883
GO:0005832	Component	Chaperonin-containing T-complex	IEA
GO:0005832	Component	Chaperonin-containing T-complex	IPI	22133715
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005874	Component	Microtubule	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	22133715, 30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	IMP	25467444
GO:0006457	Process	Protein folding	TAS	1630491
GO:0007021	Process	Tubulin complex assembly	NAS	11532003
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21753002
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	25467444
GO:0044183	Function	Protein folding chaperone	IDA	25467444, 30955883
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044297	Component	Cell body	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	25467444
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	1630491
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0090666	Process	ScaRNA localization to Cajal body	IMP	25467444
GO:0140535	Component	Intracellular protein-containing complex	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1904851	Process	Positive regulation of establishment of protein localization to telomere	IMP	25467444
GO:1904871	Process	Positive regulation of protein localization to Cajal body	HMP	25467444
GO:1904874	Process	Positive regulation of telomerase RNA localization to Cajal body	IMP	25467444

MIM	HGNC	e!Ensembl
186980	11655	ENSG00000120438

P17987

Protein name

T-complex protein 1 subunit alpha (TCP-1-alpha) (EC 3.6.1.-) (CCT-alpha) (Chaperonin containing T-complex polypeptide 1 subunit 1)

Protein function

Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of actin, tubulin and other proteins upon ATP hydrolysis (PubMed:25467444, PubMed:36493755, PubMed:35449234, PubMed:37193829). The TR

PDB

6NR8 , 6NR9 , 6NRA , 6NRB , 6NRC , 6NRD , 6QB8 , 7LUM , 7LUP , 7NVL , 7NVM , 7NVN , 7NVO , 7TRG , 7TTN , 7TTT , 7TUB , 7WU7 , 7WZ3 , 7X0A , 7X0S , 7X0V , 7X3J , 7X3U , 7X6Q , 7X7Y , 8HKI , 8I1U , 8I9U , 8IB8 , 8SFE , 8SFF , 8SG8 , 8SG9 , 8SGC , 8SGL , 8SGQ , 8SH9 , 8SHA , 8SHD , 8SHE , 8SHF , 8SHG , 8SHL , 8SHN , 8SHO , 8SHP , 8SHQ , 8SHT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00118	Cpn60_TCP1	28 → 535	TCP-1/cpn60 chaperonin family	Family

Sequence

MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGAT
ILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISG
YRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIK
YTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFS
LQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYF
VEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDE
LILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS
IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPER
KNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDD
KHGSYEDAVHSGALND

Sequence length

556

Interactions

View interactions

	Reactome
			Association of TriC/CCT with target proteins during biosynthesis BBSome-mediated cargo-targeting to cilium Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Colon adenocarcinoma	Uncertain significance	rs776891237	RCV005932446

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37416927
Breast Neoplasms	Associate	27012814, 31101846, 34868337, 35120331, 37818090
Carcinoma Hepatocellular	Associate	26229401, 34612153
Carcinoma Ovarian Epithelial	Associate	34162426
Cardiovascular Diseases	Associate	19132087
Epstein Barr Virus Infections	Stimulate	23534755
Gaucher Disease	Associate	21098288
Inflammation	Associate	19132087
Lupus Erythematosus Systemic	Stimulate	39201300
Mucocutaneous Lymph Node Syndrome	Associate	19132087
Neoplasms	Associate	34162426
Ossification Heterotopic	Associate	34612770
Ovarian Neoplasms	Associate	34162426
Scleroderma Systemic	Associate	39201300
Spondylitis Ankylosing	Inhibit	34612770

TCP1 (t-complex 1)