ZEB1 (zinc finger E-box binding homeobox 1)

Gene

• Entrez ID: 6935
• Gene name: Zinc finger E-box binding homeobox 1
• Gene symbol: ZEB1
• Synonyms (NCBI Gene): AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A
• Chromosome: 10
• Chromosome location: 10p11.22
• Summary: This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs766305306	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1057518956	C>T	Pathogenic	Stop gained, coding sequence variant
rs1554930679	CAAT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1592090713	G>T	Pathogenic	Stop gained, coding sequence variant
rs1592143384	TG>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	19703993
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Luciferase reporter assay, Western blot	18381893
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Luciferase reporter assay, Western blot	18381893
MIRT002480	hsa-miR-200a-3p	Review	19574400
MIRT002286	hsa-miR-200c-3p	Review	19574400
MIRT002483	hsa-miR-200b-3p	Review	19574400
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay	19854497
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay	18829540
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay	19854497
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	18829540
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	19839049
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	19854497
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay	19839049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay	19854497
MIRT001743	hsa-miR-429	Luciferase reporter assay	18829540
MIRT001743	hsa-miR-429	Luciferase reporter assay	19854497
MIRT002480	hsa-miR-200a-3p	qRT-PCR	19854497
MIRT002483	hsa-miR-200b-3p	qRT-PCR	19854497
MIRT001743	hsa-miR-429	intrarenal expression	19910931
MIRT002286	hsa-miR-200c-3p	immunoblot, Luciferase reporter assay, qRT-PCR	20049172
MIRT001743	hsa-miR-429	Review	20130964
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR	19854497
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR	19854497
MIRT002286	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	18483486
MIRT002286	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	18483486
MIRT002286	hsa-miR-200c-3p	qRT-PCR	19502803
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT001743	hsa-miR-429	Luciferase reporter assay, qRT-PCR	18411277
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002478	hsa-miR-205-5p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21224848
MIRT002286	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21294122
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21049046
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	21049046
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21049046
MIRT002480	hsa-miR-200a-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21389093
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21874049
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21874049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	21867514
MIRT002480	hsa-miR-200a-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21389093
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21874049
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21874049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	21867514
MIRT002286	hsa-miR-200c-3p	GFP reporter assay, qRT-PCR	16929162
MIRT002480	hsa-miR-200a-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21389093
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21874049
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21874049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	21867514
MIRT002286	hsa-miR-200c-3p	GFP reporter assay, qRT-PCR	16929162
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22407310
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22407310
MIRT006984	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	23013135
MIRT007059	hsa-miR-130b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	22847613
MIRT001743	hsa-miR-429	Reporter assay	18411277
MIRT018433	hsa-miR-335-5p	Microarray	18185580
MIRT002480	hsa-miR-200a-3p	Reporter assay	18411277
MIRT002480	hsa-miR-200a-3p	Reporter assay	18381893
MIRT002286	hsa-miR-200c-3p	Western blot	20049172
MIRT002286	hsa-miR-200c-3p	qRT-PCR;Other	19502803
MIRT002286	hsa-miR-200c-3p	Reporter assay	18381893
MIRT000317	hsa-miR-141-3p	qRT-PCR;Other	19502803
MIRT002483	hsa-miR-200b-3p	Reporter assay	18411277
MIRT002478	hsa-miR-205-5p	qRT-PCR;Other	19502803
MIRT002286	hsa-miR-200c-3p	CLASH	23622248
MIRT002483	hsa-miR-200b-3p	qRT-PCR	22294131
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22247255
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22247255
MIRT001743	hsa-miR-429	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22247255
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22735571
MIRT053160	hsa-miR-101-3p	Immunofluorescence, Luciferase reporter assay, Western blot	24677166
MIRT053244	hsa-miR-23b-3p	Luciferase reporter assay, Western blot	23844063
MIRT002286	hsa-miR-200c-3p	In situ hybridization, qRT-PCR, Western blot	22012804
MIRT000317	hsa-miR-141-3p	In situ hybridization, qRT-PCR, Western blot	22012804
MIRT053387	hsa-miR-591	Luciferase reporter assay, Western blot	23807165
MIRT053387	hsa-miR-591	Luciferase reporter assay, Western blot	23807165
MIRT053407	hsa-miR-629-5p	Microarray	23807165
MIRT053387	hsa-miR-591	Microarray	23807165
MIRT053444	hsa-miR-203a-3p	Microarray	23807165
MIRT002286	hsa-miR-200c-3p	Microarray	23807165
MIRT053515	hsa-miR-494-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23105110
MIRT053516	hsa-miR-539-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23105110
MIRT002480	hsa-miR-200a-3p	Immunofluorescence, Immunohistochemistry, In situ hybridization, qRT-PCR, Western blot	23381389
MIRT002478	hsa-miR-205-5p	Western blot	22555458
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, QRTPCR	23497265
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	25411357
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT054485	hsa-miR-655-3p	Luciferase reporter assay/Western blot, qRT-PCR	23690952
MIRT054485	hsa-miR-655-3p	Luciferase reporter assay/Western blot, qRT-PCR	23690952
MIRT054560	hsa-miR-1236-3p	Luciferase reporter assay, qRT-PCR, Western blot	24573236
MIRT054560	hsa-miR-1236-3p	Luciferase reporter assay, qRT-PCR, Western blot	24573236
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24615544
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24615544
MIRT054653	hsa-miR-183-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT054654	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	23318420
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay	23318420
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	23754305
MIRT002478	hsa-miR-205-5p	ChIP-seq, LacZ reporter assay	23474752
MIRT002478	hsa-miR-205-5p	ChIP-seq, LacZ reporter assay	23474752
MIRT002478	hsa-miR-205-5p	ChIP-seq, LacZ reporter assay	23474752
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23408168
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	Flow, qRT-PCR, Western blot	23869586
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	24127332
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	Flow, qRT-PCR, Western blot	23869586
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	24127332
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607024	hsa-miR-147a	HITS-CLIP	24906430
MIRT607023	hsa-miR-2113	HITS-CLIP	24906430
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT607021	hsa-miR-4455	HITS-CLIP	24906430
MIRT607020	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607024	hsa-miR-147a	HITS-CLIP	24906430
MIRT607023	hsa-miR-2113	HITS-CLIP	24906430
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT607021	hsa-miR-4455	HITS-CLIP	24906430
MIRT607020	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT002478	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT002478	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT731591	hsa-miR-133a-3p	Luciferase reporter assay	26902265
MIRT731591	hsa-miR-133a-3p	Luciferase reporter assay	26902265
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	26160158
MIRT731796	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27785072
MIRT731796	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27785072
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	28028835
MIRT001743	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26472725
MIRT001743	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26472725
MIRT002483	hsa-miR-200b-3p	Western blot	27373709
MIRT732321	hsa-miR-590-3p	Luciferase reporter assay, qRT-PCR, Western blot	26556542
MIRT732321	hsa-miR-590-3p	Luciferase reporter assay, qRT-PCR, Western blot	26556542
MIRT002478	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	27082508
MIRT002478	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	27082508
MIRT053160	hsa-miR-101-3p	Microarray	28416776
MIRT053160	hsa-miR-101-3p	Microarray	28416776
MIRT053160	hsa-miR-101-3p	Microarray	28416776
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT053160	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	28109909
MIRT002286	hsa-miR-200c-3p	Immunofluorescence, Immunohistochemistry, Immunoprecipitaion, qRT-PCR, Western blot	28334634
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27307751
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27307751
MIRT053160	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	27429852
MIRT607024	hsa-miR-147a	HITS-CLIP	27418678
MIRT607024	hsa-miR-147a	HITS-CLIP	27418678
MIRT607024	hsa-miR-147a	HITS-CLIP	27418678
MIRT607023	hsa-miR-2113	HITS-CLIP	27418678
MIRT607023	hsa-miR-2113	HITS-CLIP	27418678
MIRT607023	hsa-miR-2113	HITS-CLIP	27418678
MIRT607021	hsa-miR-4455	HITS-CLIP	27418678
MIRT607021	hsa-miR-4455	HITS-CLIP	27418678
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT607020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT733126	hsa-miR-34a-3p	Microarray, qRT-PCR, Western blotting	34102608
MIRT733126	hsa-miR-34a-3p	Microarray, qRT-PCR, Western blotting	34102608
MIRT054485	hsa-miR-655-3p	Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay	33902589
MIRT003137	hsa-miR-200c-3p	Immunocytochemistry (ICC), Western blotting	33045679
MIRT003141	hsa-miR-200a-3p	qRT-PCR	31734859
MIRT734548	hsa-miR-96-3p	Immunohistochemistry (IHC), RNA-seq	33318051
MIRT734647	hsa-miR-199b-5p	Luciferase reporter assay, qRT-PCR	31705138
MIRT003141	hsa-miR-200a-3p	qRT-PCR, ELISA	32691634
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT736295	hsa-miR-326	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33913391
MIRT003139	hsa-miR-200b-3p	Western blotting, qRT-PCR	34018840
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, In situ hybridization	32641995
MIRT001743	hsa-miR-429	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	32306838
MIRT737471	hsa-miR-639	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	31843451
MIRT755678	hsa-miR-142-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), Immunohistochemistry (IHC), in vitro cullelar assays, Flow cytometry	37403081
MIRT006984	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR	35402187
MIRT002483	hsa-miR-200b-3p	Western blotting, qRT-PCR	37681509
MIRT1509239	hsa-miR-101	CLIP-seq
MIRT1509240	hsa-miR-144	CLIP-seq
MIRT1509241	hsa-miR-3617	CLIP-seq
MIRT1509242	hsa-miR-4464	CLIP-seq
MIRT1509243	hsa-miR-4684-3p	CLIP-seq
MIRT1509244	hsa-miR-4709-3p	CLIP-seq
MIRT1509245	hsa-miR-4748	CLIP-seq
MIRT1509246	hsa-miR-4755-3p	CLIP-seq
MIRT1509247	hsa-miR-641	CLIP-seq
MIRT1509248	hsa-miR-297	CLIP-seq
MIRT1509249	hsa-miR-300	CLIP-seq
MIRT1509250	hsa-miR-381	CLIP-seq
MIRT1509251	hsa-miR-3929	CLIP-seq
MIRT1509252	hsa-miR-4419b	CLIP-seq
MIRT1509253	hsa-miR-4478	CLIP-seq
MIRT1509254	hsa-miR-584	CLIP-seq
MIRT1509249	hsa-miR-300	CLIP-seq
MIRT2153390	hsa-miR-3662	CLIP-seq
MIRT1509250	hsa-miR-381	CLIP-seq
MIRT2153391	hsa-miR-4282	CLIP-seq
MIRT2373668	hsa-miR-105	CLIP-seq
MIRT2373669	hsa-miR-147	CLIP-seq
MIRT1509249	hsa-miR-300	CLIP-seq
MIRT2373670	hsa-miR-3065-5p	CLIP-seq
MIRT1509250	hsa-miR-381	CLIP-seq
MIRT2373671	hsa-miR-4803	CLIP-seq
MIRT2373672	hsa-miR-599	CLIP-seq
MIRT2695631	hsa-miR-141	CLIP-seq
MIRT2695632	hsa-miR-200a	CLIP-seq
MIRT2695633	hsa-miR-3161	CLIP-seq
MIRT2695634	hsa-miR-3163	CLIP-seq
MIRT2695635	hsa-miR-340	CLIP-seq
MIRT2695636	hsa-miR-3682-3p	CLIP-seq
MIRT2153391	hsa-miR-4282	CLIP-seq
MIRT2695637	hsa-miR-4307	CLIP-seq
MIRT2695638	hsa-miR-448	CLIP-seq
MIRT2695639	hsa-miR-4502	CLIP-seq
MIRT2695640	hsa-miR-4662a-3p	CLIP-seq
MIRT2695641	hsa-miR-4735-5p	CLIP-seq
MIRT2695642	hsa-miR-4762-3p	CLIP-seq
MIRT2695643	hsa-miR-516a-3p	CLIP-seq
MIRT2695644	hsa-miR-577	CLIP-seq
MIRT2695645	hsa-miR-626	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Unknown	16804902
ERG	Unknown	21747944
ESR1	Activation	22391641
GATA3	Activation	20731704
KAT2B	Repression	22384255
LMO2	Repression	20731704
PCGF2	Repression	23474752
SALL4	Activation	23954296

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	23765923, 23814079
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	1840704
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	23765923, 23814079
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8138542
GO:0005515	Function	Protein binding	IPI	20418909
GO:0005634	Component	Nucleus	IDA	20418909, 23814079, 25190660
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8138542
GO:0007389	Process	Pattern specification process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0007417	Process	Central nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8138542
GO:0008283	Process	Cell population proliferation	IEA
GO:0010464	Process	Regulation of mesenchymal cell proliferation	IEA
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0033081	Process	Regulation of T cell differentiation in thymus	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045602	Process	Negative regulation of endothelial cell differentiation	IMP	23765923
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20418909
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	12937339
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048598	Process	Embryonic morphogenesis	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048752	Process	Semicircular canal morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051150	Process	Regulation of smooth muscle cell differentiation	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0090103	Process	Cochlea morphogenesis	IEA

Other IDs

• MIM: 189909
• HGNC: 11642
• e!Ensembl: ENSG00000148516

Protein

• UniProt ID: P37275
• Protein name: Zinc finger E-box-binding homeobox 1 (NIL-2-A zinc finger protein) (Negative regulator of IL2) (Transcription factor 8) (TCF-8)
• Protein function: Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces
• PDB: 2E19
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05605	zf-Di19	168 → 224	Drought induced 19 protein (Di19), zinc-binding	Domain
  PF00096	zf-C2H2	240 → 262	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	268 → 289	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	932 → 954	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	960 → 981	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed
• Sequence:

  MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
  LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
  NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
  RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
  KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
  RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
  ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
  DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
  QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
  INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
  ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
  QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
  YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
  SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
  VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
  NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
  QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
  DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
  ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA

• Sequence length: 1124

Pathways

KEGG:

Transcriptional misregulation in cancer
MicroRNAs in cancer
Prostate cancer

Reactome:

Interleukin-4 and Interleukin-13 signaling

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Corneal dystrophy	Likely pathogenic; Pathogenic	rs2543968405, rs2543993592, rs766305306	RCV003313267 RCV003313330 RCV000499953
Corneal dystrophy, Fuchs endothelial, 6	Likely pathogenic; Pathogenic	rs2069829602, rs2543968405, rs779148597, rs2543952522, rs1554797626	RCV001334289 RCV002463373 RCV003152395 RCV003152915 RCV003991031
Glaucoma	Pathogenic	rs1057518956	RCV000415113
Posterior polymorphous corneal dystrophy	Likely pathogenic; Pathogenic	rs2139506946, rs1057518956	RCV002466691 RCV000415113
Posterior polymorphous corneal dystrophy 1	Likely pathogenic	rs2139622959	RCV002272489
Posterior polymorphous corneal dystrophy 3	Pathogenic; Likely pathogenic	rs1458928910, rs2538531589, rs1592143384, rs2139794959, rs2543770473, rs1554797626	RCV003152396 RCV003152397 RCV000013466 RCV000013467 RCV003447694 RCV003991031
Visual loss	Pathogenic	rs1057518956	RCV000415113

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Lung cancer	Likely benign	rs138507868	RCV005907664
Malignant lymphoma, large B-cell, diffuse	Likely benign	rs138507868	RCV005907663
ZEB1-related disorder	Benign; Likely benign; Uncertain significance	rs80194531, rs140617391, rs35501784, rs567821310, rs2544007273, rs117534296, rs1577181	RCV003982838 RCV003923849 RCV003904570 RCV003899178 RCV003911616 RCV003952163 RCV003910376

Associations from Text Mining
Disease Name	Relationship Type	References
Achalasia Addisonianism Alacrimia syndrome	Associate	19921427
Adenocarcinoma	Associate	25120788
Adenocarcinoma Mucinous	Associate	32840168
Adenocarcinoma of Lung	Associate	25120788, 33191397, 33825780, 33913391, 34732702, 35342341, 36071042, 36376711, 36604626, 37406091
Adenocarcinoma of Lung	Inhibit	29116025
Adrenocortical Carcinoma	Associate	30918109
Amyotrophic lateral sclerosis 1	Inhibit	36736597
Aphasia Wernicke	Associate	25190660
Arthritis Rheumatoid	Associate	12509789, 22355377, 25880754
Asthma	Associate	35169275
Bicuspid Aortic Valve Disease	Associate	30280445
Bone Diseases	Associate	16252232
Bone Resorption	Associate	25973542
Brain Neoplasms	Associate	25521330
Breast Neoplasms	Associate	17486063, 17997862, 18321996, 19604397, 19921427, 20006705, 21224848, 21315410, 21324165, 21525039, 22632166, 23285017, 23318438, 24283570, 24508063, 25155634, 25160502, 25315069, 25733818, 25871474, 25973542, 26181203, 26334100, 26646320, 26823172, 26876920, 27036021, 27809618, 27871329, 28086235, 28247944, 28281973, 28371195, 28423483, 28852133, 29288666, 29368542, 29575368, 29744893, 30273966, 30710426, 31064130, 31467112, 31511359, 31780722, 31799668, 32313093, 32408908, 32488136, 32692442, 33087801, 33303690, 34074001, 34231077, 34446052, 34920184, 35008529, 35246504, 35440541, 35905576, 36100877, 37217832, 37356459, 37372954, 37403081, 37978168, 38139138
Breast Neoplasms	Stimulate	31880901
Calcinosis Cutis	Associate	38191418
Carcinogenesis	Associate	24577090, 29863254, 31467112, 31843451, 31978895, 35034102, 36034202, 37372954
Carcinogenesis	Stimulate	28830551
Carcinoma	Associate	25142232
Carcinoma Ductal Breast	Associate	29288666
Carcinoma Endometrioid	Associate	18487993, 29060924
Carcinoma Hepatocellular	Associate	24304617, 26617942, 26695141, 27102441, 27861158, 28488544, 29228420, 29523781, 30840268, 31843451, 33833131, 33865414, 34018840, 34496784, 35277182, 35345355, 35900486, 37138218, 40038747
Carcinoma Hepatocellular	Stimulate	31548493
Carcinoma Intraductal Noninfiltrating	Inhibit	21324165
Carcinoma Medullary	Associate	21324165
Carcinoma Non Small Cell Lung	Associate	20452118, 20980099, 22045191, 24318272, 26789630, 27396618, 27489122, 27790864, 28508744, 30840275, 31244281, 33530259, 33673439, 34642464, 35499228, 36055752, 36644609, 37834189
Carcinoma Ovarian Epithelial	Associate	26887977, 39519394
Carcinoma Ovarian Epithelial	Inhibit	28623900
Carcinoma Pancreatic Ductal	Associate	22045191, 23918833, 27424525, 29120411, 30352575, 33266052
Carcinoma Renal Cell	Associate	27031776, 27297979, 33032610
Carcinoma Squamous Cell	Associate	26617850, 26864590, 36012449, 38183060
Carcinosarcoma	Associate	37169340
Cell Transformation Neoplastic	Associate	27596438, 29744893
Cholangiocarcinoma	Associate	31978895, 32236578, 38538281
Chromosome Disorders	Associate	27930335
Colonic Neoplasms	Associate	21878201, 37946148
Colorectal Neoplasms	Associate	17486063, 21878201, 22205702, 22212097, 23174018, 23372686, 24498091, 25750173, 26455323, 26823743, 27315462, 27463018, 27533463, 27824159, 28791382, 28967064, 30097457, 31792281, 32094334, 32600257, 32669962, 34081622, 35034102, 35101080, 36510899, 37091904, 38093305, 39307879
Colorectal Neoplasms	Stimulate	29886791
Congenital myasthenic syndrome ib	Associate	33721619
Connective Tissue Diseases	Associate	19997581
Corneal Dystrophies Hereditary	Associate	23599324, 36902444
Corneal Dystrophy Fuchs Endothelial 6	Associate	23599324
Corneal dystrophy Fuchs' endothelial 1	Associate	23599324
Corneal Dystrophy Posterior Polymorphous 1	Associate	15384081, 16252232, 17437275, 17935237, 19432861, 19997581, 20036349, 20567203, 22199242, 23559851, 23599324, 24113819, 24780443, 26508574, 26619383, 26749309, 28654985, 31194824, 31201376, 36613650
Corneal Dystrophy Posterior Polymorphous 3	Associate	22199242, 23599324, 25190660, 26508574, 27537263, 29046608, 33946386, 36613650
Corneal endothelial dystrophy type 2	Associate	22199242
Coronary Artery Disease	Associate	28487391
Desmoplastic Small Round Cell Tumor	Associate	28415643
Diabetes Mellitus	Associate	26264186
Diabetic Cardiomyopathies	Associate	33215445
Diabetic Nephropathies	Associate	32294702
Dilatation Pathologic	Associate	36613650
Disease	Associate	31268360
Drug Related Side Effects and Adverse Reactions	Associate	25733818, 31467112
Endometrial Neoplasms	Associate	18487993, 18622689, 25544793, 33457409, 34948036, 37169340, 37335710
Endometrial Neoplasms	Stimulate	23743934, 26367784
Endometriosis	Associate	28597474, 32802844
Epidermolysis bullosa with pyloric atresia	Associate	35145202
Epstein Barr Virus Infections	Associate	21717425
Esophageal Neoplasms	Associate	37124931
Esophageal Squamous Cell Carcinoma	Associate	25142232, 25897987, 26617942, 28294486, 36042592
Fibrosis	Stimulate	25358403
Fibrosis	Associate	30050057
Fibrosis Of Extraocular Muscles Congenital 3A with or without Extraocular Involvement	Associate	17935237
Fuchs' Endothelial Dystrophy	Associate	20036349, 23110055, 23599324, 24348007, 25190660, 25548511, 26302187, 26622166, 27121161, 29294389, 31705138
Gallbladder Neoplasms	Associate	19116147, 34913073
Genetic Diseases Inborn	Associate	33946386
Genital Neoplasms Female	Associate	18622689
Glioblastoma	Associate	19280063, 23482671, 25521330, 25592037, 25833697, 27852622, 28945795, 29476046, 29903919, 30158599, 32179921, 33245508
Glioma	Associate	25521330, 27568035, 27589728, 27608897, 28349823, 28445977, 28945795, 29863254
Gliosarcoma	Associate	30451796, 37169340
Head and Neck Neoplasms	Associate	36982993
Hernia	Associate	17935237
Hernia Abdominal	Associate	17935237
Hernia Inguinal	Associate	16252232
Hypertension	Associate	32345067
Hypertension Pregnancy Induced	Associate	32345067
Hypospadias	Stimulate	21421232
Hypospadias	Associate	22391641
Hypoxia	Stimulate	23050024, 25521330, 30954471, 31263103, 32640738, 38183060
Hypoxia	Associate	25592037, 35246504
Hypoxia Brain	Associate	25521330
Idiopathic Pulmonary Fibrosis	Associate	25358403, 27586205
Impotence Vasculogenic	Associate	36055752
Inflammation	Associate	25120788, 30306207
Inflammatory Breast Neoplasms	Associate	26207636
Keratoconus	Associate	23599324, 36883248
Kidney Neoplasms	Associate	27871329
Klatskin Tumor	Associate	28428711
Leiomyoma	Associate	22685266
Leukemia Myeloid Acute	Associate	36812496
Lung Diseases	Associate	30050057
Lung Neoplasms	Associate	19177200, 20452118, 20980099, 25120788, 25837484, 26191328, 31244281, 33825780, 34020945
Lymphatic Metastasis	Associate	25120788, 25544793, 33761659, 36042592, 37076857, 37077062
Lymphatic Metastasis	Stimulate	25142232, 26617850, 26617942, 29771411, 30829316, 37335710
Lymphatic Metastasis	Inhibit	35905576
Lymphoma Large B Cell Diffuse	Associate	24390222, 31570691
Lymphoma Mantle Cell	Associate	30251692
Lymphoma T Cell Peripheral	Associate	32567520
Malignant mesenchymal tumor	Associate	37217832
Melanoma	Associate	21593765, 27596438, 31383874, 35029926, 37801083
Melanoma Cutaneous Malignant	Associate	35232428
Meningioma	Associate	30849635
Meningomyelocele	Associate	28735706
Mesothelioma Malignant	Associate	22086445, 35461395
Mesothelioma Malignant	Stimulate	30609805
Mixed Tumor Mullerian	Associate	18487993
Mohr Tranebjaerg syndrome	Associate	32468048
Mouth Diseases	Associate	28597474
Mouth Neoplasms	Associate	26934322, 32728068
Mycosis Fungoides	Associate	32567520
Myelodysplastic Syndromes	Associate	37408496
Myopathies Structural Congenital	Stimulate	31263103
Nasopharyngeal Carcinoma	Associate	27020592, 31760895, 37989078
Neoplasm Invasiveness	Associate	24304617, 26617850
Neoplasm Metastasis	Associate	21224848, 21315410, 22205702, 22632166, 22847613, 24577090, 25119590, 25824783, 25833697, 26617850, 26684803, 28281973, 28428711, 28967064, 29228420, 29329360, 29771411, 31072267, 31511359, 33133224, 33761659, 34081622, 34231077, 34573283, 35008529, 35342335, 35440541, 35535226, 36034202, 36346211, 36604626, 37356459, 37528489, 37989078, 38191418, 39519394
Neoplasm Metastasis	Stimulate	25409617, 25973542, 26667932, 31115480, 31894343, 32236578, 36510899, 37774079
Neoplasms	Associate	17486063, 17855508, 18381893, 18487993, 18622689, 19116147, 19435871, 19921427, 21224848, 21315410, 22080057, 22847613, 22899882, 23690952, 24304617, 24318272, 25058589, 25120788, 25160502, 25315069, 25973542, 26181203, 26214683, 26334100, 26617850, 26617942, 26764010, 26876920, 27434882, 27568035, 27596438, 28086235, 28270621, 28294486, 28387915, 28475002, 28700115, 28783176, 28791382, 28945795, 28967064, 29028100, 29060924, 29150940, 29329360, 29476046, 29744893, 29863254, 29903919, 30448260, 30487699, 30710426, 30717428, 30718355, 30829316, 30840275, 31072267, 31223610, 31263103, 31390375, 31511359, 31780722, 31843451, 31978895, 32357442, 32809114, 33032610, 33068045, 33097763, 33191397, 33530259, 33673439, 33833131, 34020945, 34446052, 34573283, 34732702, 35008529, 35034102, 36510899, 36644609, 36860286, 36879084, 36982993, 37077062, 37217832, 37335710, 37665026, 38093305, 38139138, 38183060, 39752252
Neoplasms	Stimulate	25142232, 25989272, 26823743, 28261684, 29271397, 31007650, 31040369, 32236578, 34090218
Neoplasms	Inhibit	29760516, 30097457, 30518749
Neoplasms Adipose Tissue	Associate	36890579
Neoplasms Bone Tissue	Associate	19432861
Neoplasms Cystic Mucinous and Serous	Associate	18487993
Neoplasms Squamous Cell	Associate	29329360
Nephritis Hereditary	Associate	16252232
Obesity	Associate	25630869
Odontogenic Tumors	Associate	36344906
Odontoma	Associate	27586205, 36344906
Oncocytoma renal	Associate	31655611
Oral Submucous Fibrosis	Stimulate	24400868
Oral Submucous Fibrosis	Associate	26934322, 29958727
Osteoarthritis	Associate	34990303
Osteosarcoma	Stimulate	28387915
Osteosarcoma	Associate	29523223, 30453308, 31894343, 33829438
Ovarian Diseases	Associate	25119590
Ovarian Neoplasms	Associate	18622689, 19854497, 22479527, 23554977, 24677166, 24762435, 25119590, 26887977, 29952249, 30448260, 30965236, 32247610, 34163033, 35794446, 35953860, 37774079
Pancreatic Carcinoma	Associate	30451796
Pancreatic Neoplasms	Associate	19584296, 21224848, 21909380, 25409617, 26511091, 26609108, 28212565, 29120411, 30158928, 30318866, 30487699, 31688603, 32484209, 32779876, 35186455
Pancreatic Neoplasms	Stimulate	31584877
Periodontitis	Associate	25630869
Peritonitis	Associate	39519394
Personality Disorders	Associate	18487993, 25750173, 38191418
Placenta Accreta	Stimulate	31322233
Placenta Diseases	Associate	31322233
Polycystic Ovary Syndrome	Inhibit	38243290
Pre Eclampsia	Associate	32345067
Prostatic Neoplasms	Associate	20729552, 21804603, 22249256, 23024790, 28133913, 28830551, 29028100, 29206234, 29271397, 30065348, 30754655, 30880686, 31918265, 32640738, 34884649, 35682554, 40141159
Prostatitis	Associate	21804603
Pulmonary Fibrosis	Associate	25358403, 30050057
Rectal Neoplasms	Associate	30112378
Sarcoma	Associate	27402864
Sebaceous Gland Neoplasms	Associate	29760516
Sezary Syndrome	Associate	26551670, 27039262, 30518749, 32567520
Sick Sinus Syndrome	Associate	31072267
Small Cell Lung Carcinoma	Associate	22632166
Solitary Pulmonary Nodule	Associate	26191328
Spherocytosis Type 1	Associate	37922232
Squamous Cell Carcinoma of Head and Neck	Associate	19147758, 25640197, 29150940, 32728068, 33761659, 34257531, 36034202, 36248798, 37076857, 37077062
Stickler syndrome type 3	Associate	16252232
Stomach Neoplasms	Associate	21717425, 29138864, 29295724, 29489064, 29771411, 30064133, 30829316, 31072267, 33824282, 36305048, 36580668, 36603607, 36805336
Tertiary Lymphoid Structures	Stimulate	31978895
Testicular Germ Cell Tumor	Associate	35575252
Testicular Hydrocele	Associate	16252232
Thyroid Cancer Papillary	Associate	30175973, 32335297, 33133224, 33419089
Thyroid Carcinoma Anaplastic	Associate	24126800
Thyroid Neoplasms	Associate	24126800, 24577090, 27683118, 28645161, 31846430, 39179334
Tongue Neoplasms	Associate	25890268, 26036631
Triple Negative Breast Neoplasms	Associate	19921427, 25155634, 28270621, 28423538, 29744893, 30338806, 30602372, 31427441, 34462429, 37217832, 39593161
Tuberculosis Multidrug Resistant	Associate	28668966
Urethral Neoplasms	Associate	33032610
Urinary Bladder Neoplasms	Associate	19706487, 23844063, 26544536, 27744452, 28261684, 28445936, 31115480, 34418989, 37528489
Uterine Cervical Neoplasms	Associate	25963537, 29207526, 31007650, 31263103, 33740340, 34233586, 35535226, 38183060
Uveal melanoma	Associate	26321866, 38191418